Recombinant Human IFNA1 Protein, His-tagged
| Cat.No. : | IFNA1-188H |
| Product Overview : | Recombinant Human IFNA1 fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Description : | The protein encoded by this gene is produced by macrophages and has antiviral activity. This gene is intronless and the encoded protein is secreted. |
| Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4 |
| Molecular Mass : | 20.4kD |
| AA Sequence : | CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEVDHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | IFNA1 interferon, alpha 1 [ Homo sapiens ] |
| Official Symbol | IFNA1 |
| Synonyms | IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b; leIF D; IFN-alpha 1b; IFN-alpha-1/13; interferon-alpha1; interferon alpha-D; IFN-ALPHA; IFN-alphaD; MGC138207; MGC138505; MGC138507; |
| Gene ID | 3439 |
| mRNA Refseq | NM_024013 |
| Protein Refseq | NP_076918 |
| MIM | 147660 |
| UniProt ID | P01562 |
| ◆ Recombinant Proteins | ||
| IFNA1-1027H | Active Recombinant Human IFNA1 protein, His-tagged | +Inquiry |
| Ifna1-487R | Recombinant Rat Ifna1 protein, His-tagged | +Inquiry |
| IFNA1-188H | Recombinant Human IFNA1 Protein, His-tagged | +Inquiry |
| IFNA1-136P | Recombinant Pig Interferon Alpha-1 | +Inquiry |
| Ifna1-638M | Active Recombinant Mouse Ifna1 protein, His-GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNA1-1513RCL | Recombinant Rat IFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA1 Products
Required fields are marked with *
My Review for All IFNA1 Products
Required fields are marked with *
