Recombinant Human IFNA1 Protein, His-tagged
Cat.No. : | IFNA1-188H |
Product Overview : | Recombinant Human IFNA1 fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene is produced by macrophages and has antiviral activity. This gene is intronless and the encoded protein is secreted. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4 |
Molecular Mass : | 20.4kD |
AA Sequence : | CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | IFNA1 interferon, alpha 1 [ Homo sapiens ] |
Official Symbol | IFNA1 |
Synonyms | IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b; leIF D; IFN-alpha 1b; IFN-alpha-1/13; interferon-alpha1; interferon alpha-D; IFN-ALPHA; IFN-alphaD; MGC138207; MGC138505; MGC138507; |
Gene ID | 3439 |
mRNA Refseq | NM_024013 |
Protein Refseq | NP_076918 |
MIM | 147660 |
UniProt ID | P01562 |
◆ Recombinant Proteins | ||
IFNA1-29806TH | Recombinant Human IFNA1 | +Inquiry |
IFNA1-1147H | Recombinant Human IFNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNA1-01P | Recombinant Porcine IFNA1 Protein, His-tagged | +Inquiry |
IFNA1-636G | Recombinant Guinea pig IFNA1 protein, His & T7-tagged | +Inquiry |
Ifna1-40M | Active Recombinant Mouse Ifna1 Protein (Cys24-Lys189), N-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA1-1513RCL | Recombinant Rat IFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA1 Products
Required fields are marked with *
My Review for All IFNA1 Products
Required fields are marked with *