Recombinant Human IFNA1 protein, His-tagged
| Cat.No. : | IFNA1-5633H |
| Product Overview : | Recombinant Human IFNA1 protein(P01562)(24-189aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-189a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.3 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
| Gene Name | IFNA1 interferon, alpha 1 [ Homo sapiens ] |
| Official Symbol | IFNA1 |
| Synonyms | IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b; leIF D; IFN-alpha 1b; IFN-alpha-1/13; interferon-alpha1; interferon alpha-D; IFN-ALPHA; IFN-alphaD; MGC138207; MGC138505; MGC138507; |
| Gene ID | 3439 |
| mRNA Refseq | NM_024013 |
| Protein Refseq | NP_076918 |
| MIM | 147660 |
| UniProt ID | P01562 |
| ◆ Recombinant Proteins | ||
| Ifna1-40M | Active Recombinant Mouse Ifna1 Protein (Cys24-Lys189), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| IFNA1-1816HFL | Recombinant Full Length Human IFNA1 Protein, C-Flag-tagged | +Inquiry |
| IFNA1-188H | Recombinant Human IFNA1 Protein, His-tagged | +Inquiry |
| IFNA1-3620H | Recombinant Human IFNA1 Protein (Cys24-Glu189), N-His tagged | +Inquiry |
| IFNA1-16H | Recombinant Human Interferon, Alpha 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNA1-1513RCL | Recombinant Rat IFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA1 Products
Required fields are marked with *
My Review for All IFNA1 Products
Required fields are marked with *
