Recombinant Human IFNA6 Protein, His-tagged

• Cat.No.: IFNA6-194H
• Product Overview: Recombinant Human IFNA6 fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
• Molecular Mass: 21.1kD
• AA Sequence: SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKEVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: IFNA6 interferon, alpha 6 [ Homo sapiens ]
• Official Symbol: IFNA6
• Synonyms: IFNA6; interferon, alpha 6; interferon alpha-6; IFN alphaK; leIF K; IFN-alpha-6; interferon alpha-K; interferon alpha-54; IFN-alphaK
• Gene ID: 3443
• mRNA Refseq: NM_021002
• Protein Refseq: NP_066282
• MIM: 147566
• UniProt ID: P05013