Recombinant Human IFNB1 protein, GST-tagged
Cat.No. : | IFNB1-3074H |
Product Overview : | Recombinant Human IFNB1 protein(P01574)(22-187aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 22-187aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47 kDa |
AA Sequence : | MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IFNB1 interferon, beta 1, fibroblast [ Homo sapiens ] |
Official Symbol | IFNB1 |
Synonyms | IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956; |
Gene ID | 3456 |
mRNA Refseq | NM_002176 |
Protein Refseq | NP_002167 |
MIM | 147640 |
UniProt ID | P01574 |
◆ Recombinant Proteins | ||
IFNB1-8538H | Recombinant Human IFNB1 | +Inquiry |
Ifnb1-5168R | Recombinant Rat Ifnb1 protein | +Inquiry |
IFNB1-3102H | Recombinant Human IFNB1 Protein (Met22-Asn187), His tagged | +Inquiry |
IFNB1-574H | Recombinant Human IFNB1 protein, His-Avi-tagged | +Inquiry |
IFNB1-1756H | Recombinant Horse IFNB1 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNB1-001HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
IFNB1-1117MCL | Recombinant Mouse IFNB1 cell lysate | +Inquiry |
IFNB1-889CCL | Recombinant Cynomolgus IFNB1 cell lysate | +Inquiry |
IFNB1-2931HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNB1 Products
Required fields are marked with *
My Review for All IFNB1 Products
Required fields are marked with *