Recombinant Human IFNL1 Protein
Cat.No. : | IFNL1-118H |
Product Overview : | Recombinant Human IFNL1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin 29 (IL-29), also known as IFN-λ, is a type III interferon produced by virally infected cells. IL-29 plays an important role in host defenses against microbes and antiviral activity. IL-29 shares homology with interleukin 28 (IL-28) and binds the class II cytokine receptor IL-28R. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 19.9 kDa (179 aa) |
AA Sequence : | MPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IFNL1 interferon lambda 1 [ Homo sapiens (human) ] |
Official Symbol | IFNL1 |
Synonyms | IFNL1; interferon lambda 1; IL29; IL-29; interferon lambda-1; IFN-lambda-1; cytokine Zcyto21; interleukin 29 (interferon, lambda 1); interleukin-29 |
Gene ID | 282618 |
mRNA Refseq | NM_172140 |
Protein Refseq | NP_742152 |
MIM | www.omim.org/entry/607403 |
UniProt ID | Q8IU54 |
◆ Recombinant Proteins | ||
IFNL1-3689H | Recombinant Human IFNL1 Protein (Gly20-Thr200), His tagged | +Inquiry |
IFNL1-983H | Recombinant Human IFNL1 Protein, His-tagged | +Inquiry |
IFNL1-120H | Recombinant Active Human IFNL1 Protein, His-tagged(C-ter) | +Inquiry |
IFNL1-945H | Active Recombinant Human IFNL1 Protein | +Inquiry |
IFNL1-458H | Active Recombinant Human IFNL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNL1-2007HCL | Recombinant Human IFNL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNL1 Products
Required fields are marked with *
My Review for All IFNL1 Products
Required fields are marked with *
0
Inquiry Basket