Recombinant Human IFNL1 Protein

Cat.No. : IFNL1-118H
Product Overview : Recombinant Human IFNL1 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 29 (IL-29), also known as IFN-λ, is a type III interferon produced by virally infected cells. IL-29 plays an important role in host defenses against microbes and antiviral activity. IL-29 shares homology with interleukin 28 (IL-28) and binds the class II cytokine receptor IL-28R.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 19.9 kDa (179 aa)
AA Sequence : MPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IFNL1 interferon lambda 1 [ Homo sapiens (human) ]
Official Symbol IFNL1
Synonyms IFNL1; interferon lambda 1; IL29; IL-29; interferon lambda-1; IFN-lambda-1; cytokine Zcyto21; interleukin 29 (interferon, lambda 1); interleukin-29
Gene ID 282618
mRNA Refseq NM_172140
Protein Refseq NP_742152
MIM www.omim.org/entry/607403
UniProt ID Q8IU54

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNL1 Products

Required fields are marked with *

My Review for All IFNL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon