Recombinant Human IFNW1 protein
Cat.No. : | IFNW1-534H |
Product Overview : | Recombinant Human IFNW1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 172 |
Description : | Interferon-Omega (IFN-ω) coded by IFNW1 gene in human, is a number of the type I interferon family, which includes IFN-α, IFN-β, and IFN-ω. The IFNAR-1/IFNAR-2 receptor complex can help with the signal transduction, followed the antiviral or the antiproliferative actions. IFN-ω is derived from IFN-α/β and share 75 % sequence with IFN-α. It has two intramolecular disulfide bonds which are crucial for activities. Mire-Sluis et al have described bioassays for IFN-α, IFN-β, and IFN-ω that exploit the ability of these factors to inhibit proliferation of TF-1 cells induced by GM-CSF. The bioassays can be used also with Epo and TF-1 cells, or Epo and Epo-transfected UT-7 cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human TF-1 cells is less than 0.01 ng/ml, corresponding to a specific activity of > 1.0 × 10⁸ IU/mg. |
Molecular Mass : | Approximately 20.0 kDa, containing 172 amino acid residues with two conserved disulfide bonds. |
AA Sequence : | CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS |
Endotoxin : | Less than 1 EU/μg of rHuIFN-ω as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IFNW1 |
Official Symbol | IFNW1 |
Synonyms | IFNW1; interferon, omega 1; interferon omega-1; IFN omega 1; interferon omega 1; interferon alpha-II-1; IFN-omega 1, interferon omega-1; |
Gene ID | 3467 |
mRNA Refseq | NM_002177 |
Protein Refseq | NP_002168 |
MIM | 147553 |
UniProt ID | P05000 |
◆ Recombinant Proteins | ||
IFNW1-1255B | Recombinant Bovine IFNW1 Protein, His-SUMO-tagged | +Inquiry |
IFNW1-47H | Recombinant Human Interferon, Omega 1 | +Inquiry |
IFNW1-27988TH | Recombinant Human IFNW1 | +Inquiry |
IFNW1-947H | Recombinant Human IFNW1 Protein, His-tagged | +Inquiry |
IFNW1-086H | Active Recombinant Human IFNW1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNW1-2929HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
IFNW1-1382HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNW1 Products
Required fields are marked with *
My Review for All IFNW1 Products
Required fields are marked with *
0
Inquiry Basket