Recombinant Human IFT172 protein, His-tagged
Cat.No. : | IFT172-7855H |
Product Overview : | Recombinant Human IFT172 protein(1490-1599 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1490-1599 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | SSPGTNCAEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQLETVAARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | IFT172 intraflagellar transport 172 homolog (Chlamydomonas) [ Homo sapiens ] |
Official Symbol | IFT172 |
Synonyms | SLB; wim; osm-1 |
Gene ID | 26160 |
mRNA Refseq | NM_015662.1 |
Protein Refseq | NP_056477.1 |
MIM | 607386 |
UniProt ID | Q9UG01 |
◆ Recombinant Proteins | ||
IFT172-2655R | Recombinant Rat IFT172 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFT172-2033R | Recombinant Rhesus Macaque IFT172 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFT172-461Z | Recombinant Zebrafish IFT172 | +Inquiry |
IFT172-3034H | Recombinant Human IFT172 protein, His-tagged | +Inquiry |
IFT172-2212R | Recombinant Rhesus monkey IFT172 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFT172 Products
Required fields are marked with *
My Review for All IFT172 Products
Required fields are marked with *
0
Inquiry Basket