Recombinant Human IFT46 Protein, GST-tagged

Cat.No. : IFT46-477H
Product Overview : Human C11orf60 full-length ORF ( AAH11647.1, 1 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 60.7 kDa
AA Sequence : MADNSSDECEEENNKEKKKTSQLTPQRGFSENEDDDDDDDDSSETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLVLDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEELLGKVSLPTAEIDCSLAEYIDMICAILDIPVYKSRIQSLHLLFSLYSEFKNSQHFKALAEGKKAFTPSSNSTSQAGDMETLTFS
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IFT46 intraflagellar transport 46 homolog (Chlamydomonas) [ Homo sapiens ]
Official Symbol IFT46
Synonyms intraflagellar transport 46 homolog (Chlamydomonas); chromosome 11 open reading frame 60; C11orf2; UPF0360; C11orf60; intraflagellar transport protein 46 homolog; FLJ21827; intraflagellar transport protein IFT46
Gene ID 56912
mRNA Refseq NM_020153.3
Protein Refseq NP_064538.3
UniProt ID Q9NQC8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFT46 Products

Required fields are marked with *

My Review for All IFT46 Products

Required fields are marked with *

0
cart-icon
0
compare icon