Recombinant Human IFT46 Protein, GST-tagged
Cat.No. : | IFT46-477H |
Product Overview : | Human C11orf60 full-length ORF ( AAH11647.1, 1 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 60.7 kDa |
AA Sequence : | MADNSSDECEEENNKEKKKTSQLTPQRGFSENEDDDDDDDDSSETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLVLDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEELLGKVSLPTAEIDCSLAEYIDMICAILDIPVYKSRIQSLHLLFSLYSEFKNSQHFKALAEGKKAFTPSSNSTSQAGDMETLTFS |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IFT46 intraflagellar transport 46 homolog (Chlamydomonas) [ Homo sapiens ] |
Official Symbol | IFT46 |
Synonyms | intraflagellar transport 46 homolog (Chlamydomonas); chromosome 11 open reading frame 60; C11orf2; UPF0360; C11orf60; intraflagellar transport protein 46 homolog; FLJ21827; intraflagellar transport protein IFT46 |
Gene ID | 56912 |
mRNA Refseq | NM_020153.3 |
Protein Refseq | NP_064538.3 |
UniProt ID | Q9NQC8 |
◆ Recombinant Proteins | ||
IFT46-8053M | Recombinant Mouse IFT46 Protein | +Inquiry |
IFT46-1842HF | Recombinant Full Length Human IFT46 Protein, GST-tagged | +Inquiry |
IFT46-2656R | Recombinant Rat IFT46 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFT46-3000R | Recombinant Rat IFT46 Protein | +Inquiry |
IFT46-477H | Recombinant Human IFT46 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFT46 Products
Required fields are marked with *
My Review for All IFT46 Products
Required fields are marked with *