"IGFBP4" Related Products

Expand
Expand
Expand

Recombinant Human IGFBP4 protein, T7/His-tagged

Cat.No.: IGFBP4-60H
Product Overview: Recombinant human IGFBP4 cDNA (22-258aa, derived from BC016041) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPC GVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKH FAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHP ALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro IGFBP4 mediated VEGF pathway regulation study on endothelial cell growth with this protein as either coating matrix protein or as soluble factor.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: IGFBP4 insulin-like growth factor binding protein 4 [ Homo sapiens ]
Official Symbol: IGFBP4
Synonyms: IGFBP4; insulin-like growth factor binding protein 4; insulin like growth factor binding protein 4; insulin-like growth factor-binding protein 4; BP 4; HT29 IGFBP; IBP4; IGF binding protein 4; IGFBP 4; IBP-4; IGF-binding protein 4; BP-4; IGFBP-4; HT29-IGF
Gene ID: 3487
mRNA Refseq: NM_001552
Protein Refseq: NP_001543
MIM: 146733
UniProt ID: P22692
Chromosome Location: 17q12-q21.1
Pathway: Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; Wnt signaling network, organism-specific biosystem;
Function: insulin-like growth factor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.