Recombinant Human IGFBP6 protein, T7-tagged
Cat.No. : | IGFBP6-200H |
Product Overview : | Recombinant human IGFBP6 (28-340 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 28-340 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFRCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPP KDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGP CRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTG SSG |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | IGFBP6 insulin-like growth factor binding protein 6 [ Homo sapiens ] |
Official Symbol | IGFBP6 |
Synonyms | IGFBP6; insulin-like growth factor binding protein 6; insulin-like growth factor-binding protein 6; IBP-6; IGFBP-6; IGF binding protein 6; IGF-binding protein 6; IBP6; |
Gene ID | 3489 |
mRNA Refseq | NM_002178 |
Protein Refseq | NP_002169 |
MIM | 146735 |
UniProt ID | P24592 |
Chromosome Location | 12q13 |
Pathway | Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; |
Function | insulin-like growth factor I binding; |
◆ Recombinant Proteins | ||
Igfbp6-346M | Recombinant Mouse Igfbp6 Protein, His-tagged | +Inquiry |
IGFBP6-82H | Recombinant Human insulin-like growth factor binding protein 6, His-tagged | +Inquiry |
Igfbp6-1751M | Recombinant Mouse Insulin-like Growth Factor Binding Protein 6 | +Inquiry |
IGFBP6-133H | Recombinant Human IGFBP6 Protein, His-tagged(C-ter) | +Inquiry |
IGFBP6-15914H | Recombinant Human IGFPB6, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP6-1903MCL | Recombinant Mouse IGFBP6 cell lysate | +Inquiry |
IGFBP6-1902HCL | Recombinant Human IGFBP6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFBP6 Products
Required fields are marked with *
My Review for All IGFBP6 Products
Required fields are marked with *
0
Inquiry Basket