Recombinant Human IGFBP6 protein, T7-tagged

Cat.No. : IGFBP6-200H
Product Overview : Recombinant human IGFBP6 (28-340 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 28-340 a.a.
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFRCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPP KDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGP CRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTG SSG
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name IGFBP6 insulin-like growth factor binding protein 6 [ Homo sapiens ]
Official Symbol IGFBP6
Synonyms IGFBP6; insulin-like growth factor binding protein 6; insulin-like growth factor-binding protein 6; IBP-6; IGFBP-6; IGF binding protein 6; IGF-binding protein 6; IBP6;
Gene ID 3489
mRNA Refseq NM_002178
Protein Refseq NP_002169
MIM 146735
UniProt ID P24592
Chromosome Location 12q13
Pathway Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem;
Function insulin-like growth factor I binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGFBP6 Products

Required fields are marked with *

My Review for All IGFBP6 Products

Required fields are marked with *

0
cart-icon
0
compare icon