Recombinant Human IGFBP6 protein, T7-tagged

• Cat.No.: IGFBP6-200H
• Product Overview: Recombinant human IGFBP6 (28-340 aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 28-340 a.a.
• Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFRCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPP KDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGP CRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTG SSG
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: IGFBP6 insulin-like growth factor binding protein 6 [ Homo sapiens ]
• Official Symbol: IGFBP6
• Synonyms: IGFBP6; insulin-like growth factor binding protein 6; insulin-like growth factor-binding protein 6; IBP-6; IGFBP-6; IGF binding protein 6; IGF-binding protein 6; IBP6
• Gene ID: 3489
• mRNA Refseq: NM_002178
• Protein Refseq: NP_002169
• MIM: 146735
• UniProt ID: P24592
• Chromosome Location: 12q13
• Pathway: Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem
• Function: insulin-like growth factor I binding