Recombinant Human IGHG1 protein, His-SUMO-tagged
Cat.No. : | IGHG1-3086H |
Product Overview : | Recombinant Human IGHG1 protein(P01857)(1-479aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-479aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 68.5 kDa |
AA Sequence : | MKFGLSWIFLPAILKGVQCEVQLVESGGGLVKAGGSLRLSCAASGFSFSDAWMSWARQPPGKGLEWLGRIKRKSDGGTTEYAAHVKGRFIISRDDSKYMVYMQMNSLKTEDTAVYYCNTDARSVGSLEWPNYYHGMNVWGEGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IGHG1 Immunoglobulin heavy constant gamma 1(G1m marker) [ Homo sapiens ] |
Official Symbol | IGHG1 |
Synonyms | IGHG1; Immunoglobulin heavy constant gamma 1(G1m marker); |
Gene ID | 28221 |
◆ Recombinant Proteins | ||
Ighg1-243M | Recombinant Mouse Ighg1 protein, Fc-tagged | +Inquiry |
IGHG1-372H | Active Recombinant Human IGHG1 protein, His & Avi-tagged, Biotinylated | +Inquiry |
IGHG1-4763H | Recombinant Human IGHG1 protein | +Inquiry |
IGHG1-3121H | Recombinant Human IGHG1 | +Inquiry |
IGHG1-245H | Active Recombinant Human IGHG1 Protein | +Inquiry |
◆ Native Proteins | ||
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPB-376RM | Rabbit Anti-Mouse IgG Polyclonal Antibody | +Inquiry |
CPB-106RM | Rabbit Anti-Mouse IgG Fc Secondary Polyclonal Antibody, HRP | +Inquiry |
IgG1-2886MCL | Recombinant Mouse IgG1 cell lysate | +Inquiry |
IGHG1-841HCL | Recombinant Human IGHG1 cell lysate | +Inquiry |
CPB-054RH | Rabbit Anti-Human IgG Fc Secondary Polyclonal Antibody, HRP | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGHG1 Products
Required fields are marked with *
My Review for All IGHG1 Products
Required fields are marked with *