Recombinant Human IGKV1-39 Protein, His-tagged
| Cat.No. : | IGKV1-39-11H |
| Product Overview : | Recombinant Human IGKV1-39 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Predicted to be involved in immune response. Located in blood microparticle and extracellular exosome. |
| Form : | Supplied as a 0.2 μm filtered solution in 20mM Tris, 150mM NaCl, pH8.0. |
| Molecular Mass : | ~17.3 KDa |
| AA Sequence : | MEVFDYWGQGTLVTVSSGGGGSGGGGSGGGGSTDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSAANPDTFGQGTKVEIKRAAAHHHHHHGAAEQKLISEEDLNGAA |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.5 mg/ml |
| Gene Name | IGKV1-39 immunoglobulin kappa variable 1-39 [ Homo sapiens (human) ] |
| Official Symbol | IGKV1-39 |
| Synonyms | O12; O12a; IGKV139 |
| Gene ID | 28930 |
| UniProt ID | P01597 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGKV1-39 Products
Required fields are marked with *
My Review for All IGKV1-39 Products
Required fields are marked with *
Recently Viewed
