Recombinant Human IGSF11 protein, T7/His-tagged
Cat.No. : | IGSF11-58H |
Product Overview : | Recombinant human IGSF11 cDNA (24-241aa, derived from BC034411) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 24-241 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQ PEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPP SAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASN AIGTSTCLLDLQVISPQPRNIG |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro IGSF11 mediated neuronal and testis cells differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for IGSF11 protein – protein interaction.3. May be used for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | IGSF11 immunoglobulin superfamily, member 11 [ Homo sapiens ] |
Official Symbol | IGSF11 |
Synonyms | IGSF11; immunoglobulin superfamily, member 11; immunoglobulin superfamily member 11; BT IgSF; cancer/testis antigen 119; CT119; Igsf13; MGC35227; VSIG3; CXADR like 1; V-set and immunoglobulin domain containing 3; V-set and immunoglobulin domain-containing |
Gene ID | 152404 |
mRNA Refseq | NM_001015887 |
Protein Refseq | NP_001015887 |
MIM | 608351 |
UniProt ID | Q5DX21 |
Chromosome Location | 3q21.2 |
Function | receptor activity; |
◆ Recombinant Proteins | ||
IGSF11-58H | Recombinant Human IGSF11 protein, T7/His-tagged | +Inquiry |
IGSF11-1604M | Recombinant Mouse IGSF11 protein, His-tagged | +Inquiry |
IGSF11-8317Z | Recombinant Zebrafish IGSF11 | +Inquiry |
IGSF11-237H | Active Recombinant Human IGSF11 protein, Fc-tagged | +Inquiry |
IGSF11-4762H | Recombinant Human IGSF11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGSF11-1815HCL | Recombinant Human IGSF11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGSF11 Products
Required fields are marked with *
My Review for All IGSF11 Products
Required fields are marked with *