Recombinant Human IGSF11 protein, T7/His-tagged

Cat.No. : IGSF11-58H
Product Overview : Recombinant human IGSF11 cDNA (24-241aa, derived from BC034411) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 24-241 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQ PEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPP SAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASN AIGTSTCLLDLQVISPQPRNIG
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro IGSF11 mediated neuronal and testis cells differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for IGSF11 protein – protein interaction.3. May be used for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name IGSF11 immunoglobulin superfamily, member 11 [ Homo sapiens ]
Official Symbol IGSF11
Synonyms IGSF11; immunoglobulin superfamily, member 11; immunoglobulin superfamily member 11; BT IgSF; cancer/testis antigen 119; CT119; Igsf13; MGC35227; VSIG3; CXADR like 1; V-set and immunoglobulin domain containing 3; V-set and immunoglobulin domain-containing
Gene ID 152404
mRNA Refseq NM_001015887
Protein Refseq NP_001015887
MIM 608351
UniProt ID Q5DX21
Chromosome Location 3q21.2
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGSF11 Products

Required fields are marked with *

My Review for All IGSF11 Products

Required fields are marked with *

0
cart-icon
0
compare icon