Recombinant Human IKZF2 Protein, GST-tagged

Cat.No. : IKZF2-32H
Product Overview : Human ZNFN1A2 partial ORF ( NP_057344, 298 a.a. - 397 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This protein forms homo- or hetero-dimers with other Ikaros family members, and is thought to function predominantly in early hematopoietic development. Multiple transcript variants encoding different isoforms have been found for this gene, but the biological validity of some variants has not been determined.
Molecular Mass : 36.74 kDa
AA Sequence : HFDMNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPVISSAYSQVYHPNRIERPISRETADSHENNMDGPISLIRPKSRPQERE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IKZF2
Official Symbol IKZF2 IKAROS family zinc finger 2 [ Homo sapiens (human) ]
Synonyms IKZF2; IKAROS family zinc finger 2; ANF1A2; HELIOS; ZNF1A2; ZNFN1A2; zinc finger protein Helios; ikaros family zinc finger protein 2; zinc finger DNA binding protein Helios; zinc finger protein, subfamily 1A, 2 (Helios)
Gene ID 22807
mRNA Refseq NM_016260
Protein Refseq NP_057344
MIM 606234
UniProt ID Q9UKS7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IKZF2 Products

Required fields are marked with *

My Review for All IKZF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon