"IKZF2" Related Products

Expand

Recombinant Human IKZF2 Protein, GST-tagged

Cat.No.: IKZF2-32H
Product Overview: Human ZNFN1A2 partial ORF ( NP_057344, 298 a.a. - 397 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This protein forms homo- or hetero-dimers with other Ikaros family members, and is thought to function predominantly in early hematopoietic development. Multiple transcript variants encoding different isoforms have been found for this gene, but the biological validity of some variants has not been determined.
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 36.74 kDa
AA Sequence: HFDMNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPVISSAYSQVYHPNRIERPISRETADSHENNMDGPISLIRPKSRPQERE
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: IKZF2
Official Symbol: IKZF2 IKAROS family zinc finger 2 [ Homo sapiens (human) ]
Synonyms: IKZF2; IKAROS family zinc finger 2; ANF1A2; HELIOS; ZNF1A2; ZNFN1A2; zinc finger protein Helios; ikaros family zinc finger protein 2; zinc finger DNA binding protein Helios; zinc finger protein, subfamily 1A, 2 (Helios)
Gene ID: 22807
mRNA Refseq: NM_016260
Protein Refseq: NP_057344
MIM: 606234
UniProt ID: Q9UKS7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.