Recombinant Human IL13RA2 protein

Cat.No. : IL13RA2-3829H
Product Overview : Recombinant Human IL13RA2 was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 44.2 kDa
AA Sequence : MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRN IGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAETTYWISPQGIPETKVQDMDCVYYNW QYLLCSWKPGIGVLLDTNYNLFYWYEGLDHALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRS SYFTFQLQNIVKPLPPVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTGLLLRKPNTYPKMIPE FFCDT
Applications : Antibody Production;Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet.
Notes : Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name IL13RA2 interleukin 13 receptor, alpha 2 [ Homo sapiens ]
Official Symbol IL13RA2
Synonyms IL13RA2; interleukin 13 receptor, alpha 2; interleukin-13 receptor subunit alpha-2; cancer/testis antigen 19; CD213a2; CT19; IL 13R; IL13BP; IL-13RA2; IL-13R-alpha-2; IL-13R subunit alpha-2; IL-13 receptor subunit alpha-2; interleukin 13 binding protein; interleukin-13-binding protein; interleukin 13 receptor alpha 2 chain; IL-13R; CD213A2;
Gene ID 3598
mRNA Refseq NM_000640
Protein Refseq NP_000631
MIM 300130
UniProt ID Q14627
Chromosome Location Xq13.1-q28
Pathway IL4-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function cytokine receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL13RA2 Products

Required fields are marked with *

My Review for All IL13RA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon