Recombinant Human IL13RA2 protein
Cat.No. : | IL13RA2-3829H |
Product Overview : | Recombinant Human IL13RA2 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 44.2 kDa |
AA Sequence : | MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRN IGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAETTYWISPQGIPETKVQDMDCVYYNW QYLLCSWKPGIGVLLDTNYNLFYWYEGLDHALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRS SYFTFQLQNIVKPLPPVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTGLLLRKPNTYPKMIPE FFCDT |
Applications : | Antibody Production;Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet. |
Notes : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | IL13RA2 interleukin 13 receptor, alpha 2 [ Homo sapiens ] |
Official Symbol | IL13RA2 |
Synonyms | IL13RA2; interleukin 13 receptor, alpha 2; interleukin-13 receptor subunit alpha-2; cancer/testis antigen 19; CD213a2; CT19; IL 13R; IL13BP; IL-13RA2; IL-13R-alpha-2; IL-13R subunit alpha-2; IL-13 receptor subunit alpha-2; interleukin 13 binding protein; interleukin-13-binding protein; interleukin 13 receptor alpha 2 chain; IL-13R; CD213A2; |
Gene ID | 3598 |
mRNA Refseq | NM_000640 |
Protein Refseq | NP_000631 |
MIM | 300130 |
UniProt ID | Q14627 |
Chromosome Location | Xq13.1-q28 |
Pathway | IL4-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | cytokine receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
Il13ra2-1056MAF647 | Active Recombinant Mouse Il13ra2 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
IL13RA2-218C | Recombinant Canine IL13RA2, Fc tagged | +Inquiry |
Il13ra2-1056MAF555 | Active Recombinant Mouse Il13ra2 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
IL13RA2-482H | Active Recombinant Human IL13RA2 protein, hFc-tagged | +Inquiry |
IL13RA2-766HAF647 | Recombinant Human IL13RA2 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13RA2-2758MCL | Recombinant Mouse IL13RA2 cell lysate | +Inquiry |
IL13RA2-2921HCL | Recombinant Human IL13RA2 cell lysate | +Inquiry |
IL13RA2-896CCL | Recombinant Canine IL13RA2 cell lysate | +Inquiry |
IL13RA2-1260RCL | Recombinant Rat IL13RA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL13RA2 Products
Required fields are marked with *
My Review for All IL13RA2 Products
Required fields are marked with *
0
Inquiry Basket