"IL13RA2" Related Products

Expand
Expand
Expand

Recombinant Human IL13RA2 protein

Cat.No.: IL13RA2-3829H
Product Overview: Recombinant Human IL13RA2 was expressed in Wheat Germ.
Description: The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
Source: Wheat Germ
Species: Human
Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass: 44.2 kDa
AA Sequence: MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRN IGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAETTYWISPQGIPETKVQDMDCVYYNW QYLLCSWKPGIGVLLDTNYNLFYWYEGLDHALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRS SYFTFQLQNIVKPLPPVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTGLLLRKPNTYPKMIPE FFCDT
Applications: Antibody Production;Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet.
Notes: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: IL13RA2 interleukin 13 receptor, alpha 2 [ Homo sapiens ]
Official Symbol: IL13RA2
Synonyms: IL13RA2; interleukin 13 receptor, alpha 2; interleukin-13 receptor subunit alpha-2; cancer/testis antigen 19; CD213a2; CT19; IL 13R; IL13BP; IL-13RA2; IL-13R-alpha-2; IL-13R subunit alpha-2; IL-13 receptor subunit alpha-2; interleukin 13 binding protein; interleukin-13-binding protein; interleukin 13 receptor alpha 2 chain; IL-13R; CD213A2;
Gene ID: 3598
mRNA Refseq: NM_000640
Protein Refseq: NP_000631
MIM: 300130
UniProt ID: Q14627
Chromosome Location: Xq13.1-q28
Pathway: IL4-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function: cytokine receptor activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.