Recombinant Human IL1F10 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : IL1F10-669H
Product Overview : IL1F10 MS Standard C13 and N15-labeled recombinant protein (NP_115945) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Myc&DDK
Description : The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 family members to regulate adapted and innate immune responses. Two alternatively spliced transcript variants encoding the same protein have been reported.
Molecular Mass : 17 kDa
AA Sequence : MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICTLPNRGLDRTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name IL1F10 interleukin 1 family member 10 [ Homo sapiens (human) ]
Official Symbol IL1F10
Synonyms IL1F10; interleukin 1 family, member 10 (theta); interleukin-1 family member 10; FIL1 theta; FKSG75; IL 1F10; IL 1HY2; IL1 theta; interleukin 1 receptor antagonist FKSG75; MGC11983; MGC119832; MGC119833; FIL1 theta; IL-1 theta; interleukin-1 HY2; interleukin-1 theta; IL-1F10 (canonical form IL-1F10a); interleukin-1 receptor antagonist FKSG75; interleukin-1 receptor antagonist-like FIL1 theta; IL-1HY2; IL1-theta; FIL1-theta; MGC119831;
Gene ID 84639
mRNA Refseq NM_032556
Protein Refseq NP_115945
MIM 615296
UniProt ID Q8WWZ1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL1F10 Products

Required fields are marked with *

My Review for All IL1F10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon