Recombinant Human IL8 protein
| Cat.No. : | IL8-15H |
| Product Overview : | Recombinant Human IL8 protein (72 a.a.) was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 72 |
| Description : | Interleukin-8 (IL-8) is encoded by the IL8 gene and produced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles. There are many receptors capable to bind IL-8, the most affinity to IL-8 are receptors CXCR1, and CXCR2. As a member of the CXC chemokine family, function of IL-8 is the induction of chemotaxis in its target cells, like neutrophil granulocytes, basophils, and T-cells. IL-8 (72a.a.) has a 5-10-fold higher activity on neutrophil activation, compared to IL-8 (77a.a.). IL-8 is often associated with inflammation and has been cited as a proinflammatory mediator in gingivitis and psoriasis. |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human CXCR2 transfected mouse BaF3 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
| Molecular Mass : | Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids. |
| AA Sequence : | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Endotoxin : | Less than 1 EU/µg of rHuIL-8, 72a.a./CXCL8 as determined by LAL method. |
| Purity : | >97% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | IL8 |
| Official Symbol | IL8 |
| Synonyms | IL8; interleukin 8; interleukin-8; 3 10C; alveolar macrophage chemotactic factor I; AMCF I; b ENAP; beta endothelial cell derived neutrophil activating peptide; chemokine (C X C motif) ligand 8; CXCL8; GCP 1; GCP1; granulocyte chemotactic protein 1; IL 8; K60; LECT; LUCT; lung giant cell carcinoma derived chemotactic protein; lymphocyte derived neutrophil activating peptide; LYNAP; MDNCF; MONAP; monocyte derived neutrophil chemotactic factor; monocyte derived neutrophil activating peptide; NAF; NAP 1; NAP1; neutrophil activating peptide 1; SCYB8; TSG 1; tumor necrosis factor induced gene 1; emoctakin; T-cell chemotactic factor; neutrophil-activating peptide 1; chemokine (C-X-C motif) ligand 8; beta-thromboglobulin-like protein; tumor necrosis factor-induced gene 1; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide; GCP-1; NAP-1; |
| Gene ID | 3576 |
| mRNA Refseq | NM_000584 |
| Protein Refseq | NP_000575 |
| MIM | 146930 |
| UniProt ID | P10145 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL8 Products
Required fields are marked with *
My Review for All IL8 Products
Required fields are marked with *
