Recombinant Human IL8 protein
Cat.No. : | IL8-15H |
Product Overview : | Recombinant Human IL8 protein (72 a.a.) was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 72 |
Description : | Interleukin-8 (IL-8) is encoded by the IL8 gene and produced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles. There are many receptors capable to bind IL-8, the most affinity to IL-8 are receptors CXCR1, and CXCR2. As a member of the CXC chemokine family, function of IL-8 is the induction of chemotaxis in its target cells, like neutrophil granulocytes, basophils, and T-cells. IL-8 (72a.a.) has a 5-10-fold higher activity on neutrophil activation, compared to IL-8 (77a.a.). IL-8 is often associated with inflammation and has been cited as a proinflammatory mediator in gingivitis and psoriasis. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human CXCR2 transfected mouse BaF3 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids. |
AA Sequence : | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
Endotoxin : | Less than 1 EU/µg of rHuIL-8, 72a.a./CXCL8 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL8 |
Official Symbol | IL8 |
Synonyms | IL8; interleukin 8; interleukin-8; 3 10C; alveolar macrophage chemotactic factor I; AMCF I; b ENAP; beta endothelial cell derived neutrophil activating peptide; chemokine (C X C motif) ligand 8; CXCL8; GCP 1; GCP1; granulocyte chemotactic protein 1; IL 8; K60; LECT; LUCT; lung giant cell carcinoma derived chemotactic protein; lymphocyte derived neutrophil activating peptide; LYNAP; MDNCF; MONAP; monocyte derived neutrophil chemotactic factor; monocyte derived neutrophil activating peptide; NAF; NAP 1; NAP1; neutrophil activating peptide 1; SCYB8; TSG 1; tumor necrosis factor induced gene 1; emoctakin; T-cell chemotactic factor; neutrophil-activating peptide 1; chemokine (C-X-C motif) ligand 8; beta-thromboglobulin-like protein; tumor necrosis factor-induced gene 1; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide; GCP-1; NAP-1; |
Gene ID | 3576 |
mRNA Refseq | NM_000584 |
Protein Refseq | NP_000575 |
MIM | 146930 |
UniProt ID | P10145 |
◆ Recombinant Proteins | ||
IL8-599H | Recombinant Horse Interleukin 8 | +Inquiry |
IL8-579D | Recombinant Dog IL8 Protein (23-101 aa), GST-tagged | +Inquiry |
IL8-189H | Recombinant Human IL8 Protein | +Inquiry |
IL8-172H | Active Recombinant Human IL8 Protein (Ser28-Ser99), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL8-30R | Recombinant Rabbit IL-8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL8-3004HCL | Recombinant Human IL8 cell lysate | +Inquiry |
IL8-3002HCL | Recombinant Human IL8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL8 Products
Required fields are marked with *
My Review for All IL8 Products
Required fields are marked with *
0
Inquiry Basket