Recombinant Human IMMP2L Protein, GST-tagged

Cat.No. : IMMP2L-5152H
Product Overview : Human IMMP2L partial ORF ( NP_115938, 31 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 (IMMP1L; MIM 612323) and IMP2 are the catalytic subunits of the IMP complex (Burri et al., 2005 [PubMed 15814844]).[supplied by OMIM
Molecular Mass : 33.66 kDa
AA Sequence : DRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IMMP2L IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae) [ Homo sapiens ]
Official Symbol IMMP2L
Synonyms IMMP2L; IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae); IMP2 inner mitochondrial membrane protease like (S. cerevisiae); mitochondrial inner membrane protease subunit 2; IMP2; inner mitochondrial membrane peptidase 2 like; IMP2-LIKE;
Gene ID 83943
mRNA Refseq NM_001244606
Protein Refseq NP_001231535
MIM 605977
UniProt ID Q96T52

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IMMP2L Products

Required fields are marked with *

My Review for All IMMP2L Products

Required fields are marked with *

0
cart-icon