Recombinant Human IMMP2L Protein, GST-tagged
Cat.No. : | IMMP2L-5152H |
Product Overview : | Human IMMP2L partial ORF ( NP_115938, 31 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 (IMMP1L; MIM 612323) and IMP2 are the catalytic subunits of the IMP complex (Burri et al., 2005 [PubMed 15814844]).[supplied by OMIM |
Molecular Mass : | 33.66 kDa |
AA Sequence : | DRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IMMP2L IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | IMMP2L |
Synonyms | IMMP2L; IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae); IMP2 inner mitochondrial membrane protease like (S. cerevisiae); mitochondrial inner membrane protease subunit 2; IMP2; inner mitochondrial membrane peptidase 2 like; IMP2-LIKE; |
Gene ID | 83943 |
mRNA Refseq | NM_001244606 |
Protein Refseq | NP_001231535 |
MIM | 605977 |
UniProt ID | Q96T52 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IMMP2L Products
Required fields are marked with *
My Review for All IMMP2L Products
Required fields are marked with *
0
Inquiry Basket