Recombinant Human IMMP2L protein, His-tagged

• Cat.No.: IMMP2L-3501H
• Product Overview: Recombinant Human IMMP2L protein(1-110 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-110 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRDGRKLKRI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: IMMP2L IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: IMMP2L
• Synonyms: IMMP2L; IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae); IMP2 inner mitochondrial membrane protease like (S. cerevisiae); mitochondrial inner membrane protease subunit 2; IMP2; inner mitochondrial membrane peptidase 2 like; IMP2-LIKE
• Gene ID: 83943
• mRNA Refseq: NM_001244606
• Protein Refseq: NP_001231535
• MIM: 605977
• UniProt ID: Q96T52