Recombinant Human IMP3 protein, GST-tagged
| Cat.No. : | IMP3-196H |
| Product Overview : | Recombinant Human IMP3(1 a.a. - 579 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-579 a.a. |
| Description : | This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 89.43 kDa |
| AA Sequence : | MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGHAFVDCPDESWALKAIEALSGKIELHGKPIEVEHSVP KRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLK VAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQT QSKIDVHRKENAGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK KIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGL FPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAK VRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPR DQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | IMP3 IMP3, U3 small nucleolar ribonucleoprotein [ Homo sapiens ] |
| Official Symbol | IMP3 |
| Synonyms | BRMS2; MRPS4; C15orf12; IMP3, U3 small nucleolar ribonucleoprotein, homolog; U3 snoRNP protein 3 homolog; U3 snoRNP protein IMP3 |
| Gene ID | 55272 |
| mRNA Refseq | NM_018285 |
| Protein Refseq | NP_060755 |
| MIM | 612980 |
| UniProt ID | Q9NV31 |
| Chromosome Location | 15q24 |
| Pathway | Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem |
| Function | poly(A) RNA binding; protein binding; NOT rRNA binding |
| ◆ Recombinant Proteins | ||
| IMP3-8436Z | Recombinant Zebrafish IMP3 | +Inquiry |
| IMP3-1134H | Recombinant Human IMP3 Protein, His-tagged | +Inquiry |
| IMP3-3157H | Recombinant Human IMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IMP3-2262R | Recombinant Rhesus monkey IMP3 Protein, His-tagged | +Inquiry |
| IMP3-2083R | Recombinant Rhesus Macaque IMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IMP3 Products
Required fields are marked with *
My Review for All IMP3 Products
Required fields are marked with *



