Recombinant Human IMPA1 Protein, GST-tagged
Cat.No. : | IMPA1-5144H |
Product Overview : | Human IMPA1 full-length ORF ( AAH08381, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme that dephosphorylates myo-inositol monophosphate to generate free myo-inositol, a precursor of phosphatidylinositol, and is therefore an important modulator of intracellular signal transduction via the production of the second messengers myoinositol 1,4,5-trisphosphate and diacylglycerol. This enzyme can also use myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. This enzyme shows magnesium-dependent phosphatase activity and is inhibited by therapeutic concentrations of lithium. Inhibition of inositol monophosphate hydroylosis and subsequent depletion of inositol for phosphatidylinositol synthesis may explain the anti-manic and anti-depressive effects of lithium administered to treat bipolar disorder. Alternative splicing results in multiple transcript variants encoding distinct isoforms. A pseudogene of this gene is also present on chromosome 8q21.13. [provided by RefSeq, Dec 2014] |
Molecular Mass : | 56.21 kDa |
AA Sequence : | MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 [ Homo sapiens ] |
Official Symbol | IMPA1 |
Synonyms | IMPA1; inositol(myo)-1(or 4)-monophosphatase 1; IMPA; inositol monophosphatase 1; IMP 1; IMPase 1; inositol-1(or 4)-monophosphatase 1; lithium-sensitive myo-inositol monophosphatase A1; IMP; |
Gene ID | 3612 |
mRNA Refseq | NM_001144878 |
Protein Refseq | NP_001138350 |
MIM | 602064 |
UniProt ID | P29218 |
◆ Recombinant Proteins | ||
IMPA1-841Z | Recombinant Zebrafish IMPA1 | +Inquiry |
IMPA1-770H | Recombinant Human IMPA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IMPA1-318H | Recombinant Human IMPA1 protein, His-tagged | +Inquiry |
IMPA1-29490TH | Recombinant Human IMPA1, His-tagged | +Inquiry |
IMPA1-2712R | Recombinant Rat IMPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMPA1-5214HCL | Recombinant Human IMPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IMPA1 Products
Required fields are marked with *
My Review for All IMPA1 Products
Required fields are marked with *