Recombinant Human INA protein, His-tagged
| Cat.No. : | INA-65H |
| Product Overview : | Recombinant Human INA protein(NP_116116)(1-300 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-300 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | INA internexin neuronal intermediate filament protein, alpha [ Homo sapiens ] |
| Official Symbol | INA |
| Synonyms | NEF5; NF-66; TXBP-1; FLJ18662; FLJ57501; MGC12702; INA;internexin neuronal intermediate filament protein, alpha; neurofilament 5 (66kD); neurofilament-66, tax-binding protein; Alpha-internexin; Alpha-Inx; 66 kDa neurofilament protein; Neurofilament-66 |
| Gene ID | 9118 |
| mRNA Refseq | NM_032727 |
| Protein Refseq | NP_116116 |
| MIM | 605338 |
| UniProt ID | Q16352 |
| ◆ Recombinant Proteins | ||
| INA-8202M | Recombinant Mouse INA Protein | +Inquiry |
| INA-6955HF | Recombinant Full Length Human INA Protein, GST-tagged | +Inquiry |
| INA-64H | Recombinant Human INA | +Inquiry |
| INA-2267R | Recombinant Rhesus monkey INA Protein, His-tagged | +Inquiry |
| INA-829H | Recombinant Human INA, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INA Products
Required fields are marked with *
My Review for All INA Products
Required fields are marked with *
