Recombinant Human ING3 Protein, GST-tagged
| Cat.No. : | ING3-5129H |
| Product Overview : | Human ING3 full-length ORF ( AAH09776, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq |
| Molecular Mass : | 35.86 kDa |
| AA Sequence : | MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ING3 inhibitor of growth family, member 3 [ Homo sapiens ] |
| Official Symbol | ING3 |
| Synonyms | ING3; inhibitor of growth family, member 3; inhibitor of growth protein 3; Eaf4; FLJ20089; MEAF4; p47ING3; ING2; |
| Gene ID | 54556 |
| mRNA Refseq | NM_019071 |
| Protein Refseq | NP_061944 |
| MIM | 607493 |
| UniProt ID | Q9NXR8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ING3 Products
Required fields are marked with *
My Review for All ING3 Products
Required fields are marked with *
