Recombinant Human ING3 Protein, GST-tagged

Cat.No. : ING3-5129H
Product Overview : Human ING3 full-length ORF ( AAH09776, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq
Molecular Mass : 35.86 kDa
AA Sequence : MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ING3 inhibitor of growth family, member 3 [ Homo sapiens ]
Official Symbol ING3
Synonyms ING3; inhibitor of growth family, member 3; inhibitor of growth protein 3; Eaf4; FLJ20089; MEAF4; p47ING3; ING2;
Gene ID 54556
mRNA Refseq NM_019071
Protein Refseq NP_061944
MIM 607493
UniProt ID Q9NXR8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ING3 Products

Required fields are marked with *

My Review for All ING3 Products

Required fields are marked with *

0
cart-icon
0
compare icon