Recombinant Human ING3 protein, GST-tagged
Cat.No. : | ING3-301316H |
Product Overview : | Recombinant Human ING3 (1-92 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Phe92 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ING3 inhibitor of growth family, member 3 [ Homo sapiens ] |
Official Symbol | ING3 |
Synonyms | ING3; inhibitor of growth family, member 3; inhibitor of growth protein 3; Eaf4; FLJ20089; MEAF4; p47ING3; ING2; |
Gene ID | 54556 |
mRNA Refseq | NM_019071 |
Protein Refseq | NP_061944 |
MIM | 607493 |
UniProt ID | Q9NXR8 |
◆ Recombinant Proteins | ||
ING3-3884H | Recombinant Human ING3 protein, His-tagged | +Inquiry |
ING3-3063R | Recombinant Rat ING3 Protein | +Inquiry |
ING3-301316H | Recombinant Human ING3 protein, GST-tagged | +Inquiry |
ING3-4544M | Recombinant Mouse ING3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ING3-2434C | Recombinant Chicken ING3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ING3-5207HCL | Recombinant Human ING3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ING3 Products
Required fields are marked with *
My Review for All ING3 Products
Required fields are marked with *