Recombinant Human INHBC Protein, N-His tagged

• Cat.No.: INHBC-02H
• Product Overview: Recombinant Human INHBC Protein with N-His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of homodimeric and heterodimeric activin complexes. The heterodimeric complex may function in the inhibition of activin A signaling. Transgenic mice overexpressing this gene exhibit defects in testis, liver and prostate.
• Molecular Mass: The protein has a calculated MW of 14.2 kDa.
• AA Sequence: HHHHHHHHDDDDKGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.27 mg/mL by BCA
• Storage Buffer: PBS, pH 7.4, 10% Glycerol, 1% SKL

Gene Information

• Gene Name: INHBC inhibin, beta C [ Homo sapiens (human) ]
• Official Symbol: INHBC
• Synonyms: INHBC; inhibin, beta C; inhibin beta C chain; activin beta-C chain; IHBC
• Gene ID: 3626
• mRNA Refseq: NM_005538
• Protein Refseq: NP_005529
• MIM: 601233
• UniProt ID: P55103