Recombinant Human INHBC Protein, N-His tagged
| Cat.No. : | INHBC-02H | 
| Product Overview : | Recombinant Human INHBC Protein with N-His tag was expressed in HEK293. | 
| Availability | November 04, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | His | 
| Description : | This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of homodimeric and heterodimeric activin complexes. The heterodimeric complex may function in the inhibition of activin A signaling. Transgenic mice overexpressing this gene exhibit defects in testis, liver and prostate. | 
| Molecular Mass : | The protein has a calculated MW of 14.2 kDa. | 
| AA Sequence : | HHHHHHHHDDDDKGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS | 
| Purity : | > 90% by SDS-PAGE | 
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 0.27 mg/mL by BCA | 
| Storage Buffer : | PBS, pH 7.4, 10% Glycerol, 1% SKL | 
| Gene Name | INHBC inhibin, beta C [ Homo sapiens (human) ] | 
| Official Symbol | INHBC | 
| Synonyms | INHBC; inhibin, beta C; inhibin beta C chain; activin beta-C chain; IHBC; | 
| Gene ID | 3626 | 
| mRNA Refseq | NM_005538 | 
| Protein Refseq | NP_005529 | 
| MIM | 601233 | 
| UniProt ID | P55103 | 
| ◆ Recombinant Proteins | ||
| Inhbc-01M | Active Recombinant Mouse Inhbc Protein | +Inquiry | 
| INHBC-8215M | Recombinant Mouse INHBC Protein | +Inquiry | 
| INHBC-3373H | Recombinant Human INHBC Protein (Thr19-Ser352), C-His tagged | +Inquiry | 
| INHBC-2401H | Recombinant Human INHBC Protein, MYC/DDK-tagged | +Inquiry | 
| INHBC-5116H | Recombinant Human INHBC Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| INHBC-346HCL | Recombinant Human INHBC lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All INHBC Products
Required fields are marked with *
My Review for All INHBC Products
Required fields are marked with *
  
        
    
      
            