Recombinant Human INHBC Protein, N-His tagged

Cat.No. : INHBC-02H
Product Overview : Recombinant Human INHBC Protein with N-His tag was expressed in HEK293.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of homodimeric and heterodimeric activin complexes. The heterodimeric complex may function in the inhibition of activin A signaling. Transgenic mice overexpressing this gene exhibit defects in testis, liver and prostate.
Molecular Mass : The protein has a calculated MW of 14.2 kDa.
AA Sequence : HHHHHHHHDDDDKGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.27 mg/mL by BCA
Storage Buffer : PBS, pH 7.4, 10% Glycerol, 1% SKL
Gene Name INHBC inhibin, beta C [ Homo sapiens (human) ]
Official Symbol INHBC
Synonyms INHBC; inhibin, beta C; inhibin beta C chain; activin beta-C chain; IHBC;
Gene ID 3626
mRNA Refseq NM_005538
Protein Refseq NP_005529
MIM 601233
UniProt ID P55103

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All INHBC Products

Required fields are marked with *

My Review for All INHBC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon