Recombinant Human ING1 protein, His-tagged
Cat.No. : | ING1-668H |
Product Overview : | Recombinant Human ING1 protein(1-279 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-279 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ING1 inhibitor of growth family, member 1 [ Homo sapiens ] |
Official Symbol | ING1 |
Synonyms | ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1; |
Gene ID | 3621 |
mRNA Refseq | NM_005537 |
Protein Refseq | NP_005528 |
MIM | 601566 |
UniProt ID | Q9UK53 |
◆ Recombinant Proteins | ||
ING1-28775TH | Recombinant Human ING1 | +Inquiry |
ING1-2089R | Recombinant Rhesus Macaque ING1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ING1-5873HF | Recombinant Full Length Human ING1 Protein, GST-tagged | +Inquiry |
ING1-721H | Recombinant Human ING1 Protein, His-tagged | +Inquiry |
ING1-8207M | Recombinant Mouse ING1 Protein | +Inquiry |
◆ Native Proteins | ||
ING1-001H | Recombinant Human ING1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ING1-860HCL | Recombinant Human ING1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ING1 Products
Required fields are marked with *
My Review for All ING1 Products
Required fields are marked with *