Recombinant Human INMT Protein (1-263 aa), His-SUMO-tagged
| Cat.No. : | INMT-584H |
| Product Overview : | Recombinant Human INMT Protein (1-263 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length. |
| Availability | July 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-263 aa |
| Description : | Functions as thioether S-methyltransferase and is active with a variety of thioethers and the corresponding selenium and tellurium compounds, including 3-methylthiopropionaldehyde, dimethyl selenide, dimethyl telluride, 2-methylthioethylamine, 2-methylthioethanol, methyl-n-propyl sulfide and diethyl sulfide. Plays an important role in the detoxification of selenium compounds . Catalyzes the N-methylation of tryptamine and structurally related compounds.1 Publication. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 44.9 kDa |
| AA Sequence : | MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | INMT indolethylamine N-methyltransferase [ Homo sapiens ] |
| Official Symbol | INMT |
| Synonyms | INMT; MGC125940; MGC125941; |
| Gene ID | 11185 |
| mRNA Refseq | NM_001199219 |
| Protein Refseq | NP_001186148 |
| MIM | 604854 |
| UniProt ID | O95050 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INMT Products
Required fields are marked with *
My Review for All INMT Products
Required fields are marked with *
