Recombinant Human INMT Protein (1-263 aa), His-SUMO-tagged
Cat.No. : | INMT-584H |
Product Overview : | Recombinant Human INMT Protein (1-263 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-263 aa |
Description : | Functions as thioether S-methyltransferase and is active with a variety of thioethers and the corresponding selenium and tellurium compounds, including 3-methylthiopropionaldehyde, dimethyl selenide, dimethyl telluride, 2-methylthioethylamine, 2-methylthioethanol, methyl-n-propyl sulfide and diethyl sulfide. Plays an important role in the detoxification of selenium compounds . Catalyzes the N-methylation of tryptamine and structurally related compounds.1 Publication. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | INMT indolethylamine N-methyltransferase [ Homo sapiens ] |
Official Symbol | INMT |
Synonyms | INMT; MGC125940; MGC125941; |
Gene ID | 11185 |
mRNA Refseq | NM_001199219 |
Protein Refseq | NP_001186148 |
MIM | 604854 |
UniProt ID | O95050 |
◆ Recombinant Proteins | ||
INMT-3771H | Recombinant Human INMT protein, GST-tagged | +Inquiry |
INMT-6553H | Recombinant Human INMT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
INMT-2093R | Recombinant Rhesus Macaque INMT Protein, His (Fc)-Avi-tagged | +Inquiry |
INMT-2272R | Recombinant Rhesus monkey INMT Protein, His-tagged | +Inquiry |
INMT-2399H | Recombinant Human INMT Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INMT-347HCL | Recombinant Human INMT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INMT Products
Required fields are marked with *
My Review for All INMT Products
Required fields are marked with *
0
Inquiry Basket