Recombinant Human INPP5B protein, His-tagged
Cat.No. : | INPP5B-3633H |
Product Overview : | Recombinant Human INPP5B protein(1-309 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-309 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRMFLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | INPP5B inositol polyphosphate-5-phosphatase, 75kDa [ Homo sapiens ] |
Official Symbol | INPP5B |
Synonyms | INPP5B; inositol polyphosphate-5-phosphatase, 75kDa; inositol polyphosphate 5 phosphatase, 75kD; type II inositol 1,4,5-trisphosphate 5-phosphatase; phosphoinositide 5-phosphatase; 75 kDa inositol polyphosphate-5-phosphatase; type II inositol-1,4,5-trisphosphate 5-phosphatase; 5PTase; MGC65156; MGC71303; |
Gene ID | 3633 |
mRNA Refseq | NM_005540 |
Protein Refseq | NP_005531 |
MIM | 147264 |
UniProt ID | P32019 |
◆ Recombinant Proteins | ||
INPP5B-3633H | Recombinant Human INPP5B protein, His-tagged | +Inquiry |
INPP5B-5106H | Recombinant Human INPP5B Protein, GST-tagged | +Inquiry |
INPP5B-258HF | Recombinant Full Length Human INPP5B Protein | +Inquiry |
INPP5B-8226M | Recombinant Mouse INPP5B Protein | +Inquiry |
INPP5B-4556M | Recombinant Mouse INPP5B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INPP5B-861HCL | Recombinant Human INPP5B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INPP5B Products
Required fields are marked with *
My Review for All INPP5B Products
Required fields are marked with *