Recombinant Human INS Protein
| Cat.No. : | INS-61H |
| Product Overview : | Recombinant Human INS Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified, including insulin-dependent diabetes mellitus, permanent neonatal diabetes diabetes mellitus, maturity-onset diabetes of the young type 10 and hyperproinsulinemia. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. |
| Form : | Liquid. In 20 mM Tris-HCl, 150 mM NaCl, pH 8.0. |
| Molecular Mass : | ~12.8 kDa |
| AA Sequence : | HHHHHHMDDDDKFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALNAVEVLKREPLNYLPLEGSLQKRGIVEQCCTSICSLYQLENYCN |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.34 mg/ml |
| Official Full Name : | Insulin |
| Gene Name | INS insulin [ Homo sapiens (human) ] |
| Official Symbol | INS |
| Synonyms | IDDM; ILPR; IRDN; IDDM1; IDDM2; PNDM4; MODY10 |
| Gene ID | 3630 |
| mRNA Refseq | NM_000207 |
| Protein Refseq | NP_000198 |
| MIM | 176730 |
| UniProt ID | P01308 |
| ◆ Recombinant Proteins | ||
| INS-5100H | Recombinant Human INS Protein, GST-tagged | +Inquiry |
| INS-674H | Recombinant Human INS Protein, His/GST-tagged | +Inquiry |
| INS-607H | Active Recombinant Human INS, Met, His&Lys-tagged | +Inquiry |
| INS-41P | Porcine Insulin | +Inquiry |
| INS-321H | Recombinant Human INS protein | +Inquiry |
| ◆ Native Proteins | ||
| INS-512D | Native Bovine INS | +Inquiry |
| INS-5435B | Native Bovine Insulin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
