Recombinant Human INS therapeutic protein
Cat.No. : | INS-P040H |
Product Overview : | Recombinant Human INS therapeutic protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 30 aa |
Description : | The expression product is the active ingredient of Novolin R. |
Molecular Mass : | 5.8 kDa |
AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Gene Name | INS insulin [ Homo sapiens ] |
Official Symbol | INS |
Synonyms | INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10; |
Gene ID | 3630 |
mRNA Refseq | NM_000207 |
Protein Refseq | NP_000198 |
UniProt ID | P01308 |
Chromosome Location | 11p15.5 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function | hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; |
◆ Recombinant Proteins | ||
INS-341H | Recombinant Human INS | +Inquiry |
INS-677P | Recombinant Pig INS Protein, His/GST-tagged | +Inquiry |
INS-1759H | Recombinant Human INS protein, His & T7-tagged | +Inquiry |
INS-191HFL | Active Recombinant Full Length Human INS Protein, C-Flag-tagged | +Inquiry |
INS-60H | Recombinant Human INS Protein | +Inquiry |
◆ Native Proteins | ||
INS-5435B | Native Bovine Insulin | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
◆ Cell & Tissue Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
0
Inquiry Basket