Recombinant Human INS therapeutic protein
Cat.No. : | INS-P040H |
Product Overview : | Recombinant Human INS therapeutic protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Description : | The expression product is the active ingredient of Novolin R. |
Source : | E. coli |
Species : | Human |
Molecular Mass : | 5.8 kDa |
Protein length : | 30 aa |
AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Gene Name : | INS insulin [ Homo sapiens ] |
Official Symbol : | INS |
Synonyms : | INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10; |
Gene ID : | 3630 |
mRNA Refseq : | NM_000207 |
Protein Refseq : | NP_000198 |
UniProt ID : | P01308 |
Chromosome Location : | 11p15.5 |
Pathway : | ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function : | hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; |
Products Types
◆ Native Protein | ||
INS-512D | Native Bovine INS | +Inquiry |
INS-5435B | Native Bovine Insulin | +Inquiry |
◆ Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket