Recombinant Human INS therapeutic protein
| Cat.No. : | INS-P040H |
| Product Overview : | Recombinant Human INS therapeutic protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 30 aa |
| Description : | The expression product is the active ingredient of Novolin R. |
| Molecular Mass : | 5.8 kDa |
| AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Endotoxin : | < 1.0 EU per μg of the protein |
| Purity : | >95% |
| Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
| Gene Name | INS insulin [ Homo sapiens ] |
| Official Symbol | INS |
| Synonyms | INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10; |
| Gene ID | 3630 |
| mRNA Refseq | NM_000207 |
| Protein Refseq | NP_000198 |
| UniProt ID | P01308 |
| Chromosome Location | 11p15.5 |
| Pathway | ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
| Function | hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; |
| ◆ Recombinant Proteins | ||
| INS-64P | Recombinant Pongo pygmaeus INS1 Protein | +Inquiry |
| INS-674B | Recombinant Bovine INS protein, His-KSI-tagged | +Inquiry |
| INS-10B | Recombinant Bovine INS protein | +Inquiry |
| INS-5978HF | Recombinant Full Length Human INS Protein, GST-tagged | +Inquiry |
| INS-607H | Active Recombinant Human INS, Met, His&Lys-tagged | +Inquiry |
| ◆ Native Proteins | ||
| INS-512D | Native Bovine INS | +Inquiry |
| INS-5435B | Native Bovine Insulin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
