Recombinant Human INSIG2 Protein, GST-tagged
Cat.No. : | INSIG2-5098H |
Product Overview : | Human INSIG2 full-length ORF ( AAH22475, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq |
Molecular Mass : | 50.49 kDa |
AA Sequence : | MAEGETEPPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQPLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAVYECKVIAEKSHQE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | INSIG2 insulin induced gene 2 [ Homo sapiens (human) ] |
Official Symbol | INSIG2 |
Synonyms | INSIG2; insulin induced gene 2; INSIG-2; insulin-induced gene 2 protein; INSIG2 membrane protein; insulin induced protein 2 |
Gene ID | 51141 |
mRNA Refseq | NM_001321329 |
Protein Refseq | NP_001308258 |
MIM | 608660 |
UniProt ID | Q9Y5U4 |
◆ Cell & Tissue Lysates | ||
INSIG2-5192HCL | Recombinant Human INSIG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSIG2 Products
Required fields are marked with *
My Review for All INSIG2 Products
Required fields are marked with *