Recombinant Human INSIG2 Protein, GST-tagged

Cat.No. : INSIG2-5098H
Product Overview : Human INSIG2 full-length ORF ( AAH22475, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq
Molecular Mass : 50.49 kDa
AA Sequence : MAEGETEPPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQPLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAVYECKVIAEKSHQE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name INSIG2 insulin induced gene 2 [ Homo sapiens (human) ]
Official Symbol INSIG2
Synonyms INSIG2; insulin induced gene 2; INSIG-2; insulin-induced gene 2 protein; INSIG2 membrane protein; insulin induced protein 2
Gene ID 51141
mRNA Refseq NM_001321329
Protein Refseq NP_001308258
MIM 608660
UniProt ID Q9Y5U4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INSIG2 Products

Required fields are marked with *

My Review for All INSIG2 Products

Required fields are marked with *

0
cart-icon