Recombinant Human INSIG2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | INSIG2-2114H |
Product Overview : | INSIG2 MS Standard C13 and N15-labeled recombinant protein (NP_057217) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. |
Molecular Mass : | 24.8 kDa |
AA Sequence : | MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | INSIG2 insulin induced gene 2 [ Homo sapiens (human) ] |
Official Symbol | INSIG2 |
Synonyms | INSIG2; insulin induced gene 2; INSIG-2; insulin-induced gene 2 protein; INSIG2 membrane protein; insulin induced protein 2 |
Gene ID | 51141 |
mRNA Refseq | NM_016133 |
Protein Refseq | NP_057217 |
MIM | 608660 |
UniProt ID | Q9Y5U4 |
◆ Recombinant Proteins | ||
Insig2-3552M | Recombinant Mouse Insig2 Protein, Myc/DDK-tagged | +Inquiry |
RFL10815SF | Recombinant Full Length Pig Insulin-Induced Gene 2 Protein(Insig2) Protein, His-Tagged | +Inquiry |
RFL32211XF | Recombinant Full Length Xenopus Laevis Insulin-Induced Gene 2 Protein(Insig2) Protein, His-Tagged | +Inquiry |
INSIG2-3079R | Recombinant Rat INSIG2 Protein | +Inquiry |
INSIG2-2114H | Recombinant Human INSIG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
INSIG2-5192HCL | Recombinant Human INSIG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSIG2 Products
Required fields are marked with *
My Review for All INSIG2 Products
Required fields are marked with *