Recombinant Human INSL3 Protein, His-tagged
| Cat.No. : | INSL3-722H |
| Product Overview : | Recombinant Human INSL3 fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Description : | This gene encodes a member of the insulin-like hormone superfamily. The encoded protein is mainly produced in gonadal tissues. Studies of the mouse counterpart suggest that this gene may be involved in the development of urogenital tract and female fertility. This protein may also act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent. Mutations in this gene may lead to cryptorchidism. Alternate splicing results in multiple transcript variants. |
| Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4 |
| Molecular Mass : | 13.4kD |
| AA Sequence : | LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPYVDHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | INSL3 insulin-like 3 (Leydig cell) [ Homo sapiens ] |
| Official Symbol | INSL3 |
| Synonyms | INSL3; insulin-like 3 (Leydig cell); relaxin like factor , RLNL; insulin-like 3; MGC119818; MGC119819; RLF; ley-I-L; relaxin-like factor b; leydig insulin-like peptide; leydig insulin -like hormone; leydig insulin -like peptide; RLNL; |
| Gene ID | 3640 |
| mRNA Refseq | NM_005543 |
| Protein Refseq | NP_005534 |
| MIM | 146738 |
| UniProt ID | P51460 |
| ◆ Recombinant Proteins | ||
| INSL3-722H | Recombinant Human INSL3 Protein, His-tagged | +Inquiry |
| INSL3-4101H | Recombinant Human INSL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| INSL3-3376H | Recombinant Human INSL3 Protein (Leu21-Tyr131), C-His tagged | +Inquiry |
| Insl3-3553M | Recombinant Mouse Insl3 Protein, Myc/DDK-tagged | +Inquiry |
| Insl3-1062R | Recombinant Rat Insl3 Protein, His&SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INSL3-5191HCL | Recombinant Human INSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSL3 Products
Required fields are marked with *
My Review for All INSL3 Products
Required fields are marked with *
