Recombinant Human INSRR Protein, GST-tagged
| Cat.No. : | INSRR-5090H |
| Product Overview : | Human INSRR partial ORF ( NP_055030, 651 a.a. - 760 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | INSRR (Insulin Receptor Related Receptor) is a Protein Coding gene. Diseases associated with INSRR include Podoconiosis and Neurofibrosarcoma. Among its related pathways are GPCR Pathway and MAPK Signaling: Mitogen Stimulation Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is IGF1R. |
| Molecular Mass : | 37.73 kDa |
| AA Sequence : | LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | INSRR insulin receptor-related receptor [ Homo sapiens ] |
| Official Symbol | INSRR |
| Synonyms | INSRR; insulin receptor-related receptor; insulin receptor-related protein; IRR; IR-related receptor; |
| Gene ID | 3645 |
| mRNA Refseq | NM_014215 |
| Protein Refseq | NP_055030 |
| MIM | 147671 |
| UniProt ID | P14616 |
| ◆ Recombinant Proteins | ||
| INSRR-724H | Recombinant Human INSRR Protein, DDK-tagged | +Inquiry |
| INSRR-2446H | Recombinant Human INSRR Protein, MYC/DDK-tagged | +Inquiry |
| INSRR-1865H | Recombinant Human Insulin Receptor-Related Receptor, GAT-tagged | +Inquiry |
| Insrr-3555M | Recombinant Mouse Insrr Protein, Myc/DDK-tagged | +Inquiry |
| INSRR-1189H | Recombinant Human INSRR Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSRR Products
Required fields are marked with *
My Review for All INSRR Products
Required fields are marked with *



