"INSRR" Related Products

Expand

Recombinant Human INSRR Protein, GST-tagged

Cat.No.: INSRR-5090H
Product Overview: Human INSRR partial ORF ( NP_055030, 651 a.a. - 760 a.a.) recombinant protein with GST-tag at N-terminal.
Description: INSRR (Insulin Receptor Related Receptor) is a Protein Coding gene. Diseases associated with INSRR include Podoconiosis and Neurofibrosarcoma. Among its related pathways are GPCR Pathway and MAPK Signaling: Mitogen Stimulation Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is IGF1R.
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 37.73 kDa
AA Sequence: LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: INSRR insulin receptor-related receptor [ Homo sapiens ]
Official Symbol: INSRR
Synonyms: INSRR; insulin receptor-related receptor; insulin receptor-related protein; IRR; IR-related receptor;
Gene ID: 3645
mRNA Refseq: NM_014215
Protein Refseq: NP_055030
MIM: 147671
UniProt ID: P14616

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.