Recombinant Human INSRR Protein, GST-tagged

• Cat.No.: INSRR-5090H
• Product Overview: Human INSRR partial ORF ( NP_055030, 651 a.a. - 760 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: INSRR (Insulin Receptor Related Receptor) is a Protein Coding gene. Diseases associated with INSRR include Podoconiosis and Neurofibrosarcoma. Among its related pathways are GPCR Pathway and MAPK Signaling: Mitogen Stimulation Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is IGF1R.
• Molecular Mass: 37.73 kDa
• AA Sequence: LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INSRR insulin receptor-related receptor [ Homo sapiens ]
• Official Symbol: INSRR
• Synonyms: INSRR; insulin receptor-related receptor; insulin receptor-related protein; IRR; IR-related receptor
• Gene ID: 3645
• mRNA Refseq: NM_014215
• Protein Refseq: NP_055030
• MIM: 147671
• UniProt ID: P14616