Recombinant Human INSRR Protein, GST-tagged

Cat.No. : INSRR-5090H
Product Overview : Human INSRR partial ORF ( NP_055030, 651 a.a. - 760 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : INSRR (Insulin Receptor Related Receptor) is a Protein Coding gene. Diseases associated with INSRR include Podoconiosis and Neurofibrosarcoma. Among its related pathways are GPCR Pathway and MAPK Signaling: Mitogen Stimulation Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is IGF1R.
Molecular Mass : 37.73 kDa
AA Sequence : LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name INSRR insulin receptor-related receptor [ Homo sapiens ]
Official Symbol INSRR
Synonyms INSRR; insulin receptor-related receptor; insulin receptor-related protein; IRR; IR-related receptor;
Gene ID 3645
mRNA Refseq NM_014215
Protein Refseq NP_055030
MIM 147671
UniProt ID P14616

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INSRR Products

Required fields are marked with *

My Review for All INSRR Products

Required fields are marked with *

0
cart-icon
0
compare icon