Recombinant Human Integrin beta-5 protein, His-tagged
Cat.No. : | ITGB5-3312H |
Product Overview : | Recombinant Human ITGB5 protein(24-126 aa), fused to His tag, was expressed in E. coli. |
Availability | April 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-126 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ITGB5 integrin, beta 5 [ Homo sapiens ] |
Official Symbol | ITGB5 |
Synonyms | ITGB5; integrin, beta 5; integrin beta-5; FLJ26658; |
Gene ID | 3693 |
mRNA Refseq | NM_002213 |
Protein Refseq | NP_002204 |
MIM | 147561 |
UniProt ID | P18084 |
◆ Recombinant Proteins | ||
ITGB5-2645H | Recombinant Human ITGB5 Protein, MYC/DDK-tagged | +Inquiry |
ITGB5-3312H | Recombinant Human Integrin beta-5 protein, His-tagged | +Inquiry |
ITGB5-6053C | Recombinant Chicken ITGB5 | +Inquiry |
RFL3913MF | Recombinant Full Length Mouse Integrin Beta-5(Itgb5) Protein, His-Tagged | +Inquiry |
ITGB5-301576H | Recombinant Human ITGB5 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB5-880HCL | Recombinant Human ITGB5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB5 Products
Required fields are marked with *
My Review for All ITGB5 Products
Required fields are marked with *
0
Inquiry Basket