Recombinant Human Integrin beta-5 protein, His-tagged
| Cat.No. : | ITGB5-3312H |
| Product Overview : | Recombinant Human ITGB5 protein(24-126 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-126 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ITGB5 integrin, beta 5 [ Homo sapiens ] |
| Official Symbol | ITGB5 |
| Synonyms | ITGB5; integrin, beta 5; integrin beta-5; FLJ26658; |
| Gene ID | 3693 |
| mRNA Refseq | NM_002213 |
| Protein Refseq | NP_002204 |
| MIM | 147561 |
| UniProt ID | P18084 |
| ◆ Recombinant Proteins | ||
| ITGB5-3124H | Recombinant Human ITGB5 Protein (Pro137-Ile378), His tagged | +Inquiry |
| RFL4287BF | Recombinant Full Length Bovine Integrin Beta-5(Itgb5) Protein, His-Tagged | +Inquiry |
| ITGB5-8369M | Recombinant Mouse ITGB5 Protein | +Inquiry |
| ITGB5-251H | Recombinant Human ITGB5 Protein, His-tagged | +Inquiry |
| ITGB5-301576H | Recombinant Human ITGB5 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGB5-880HCL | Recombinant Human ITGB5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB5 Products
Required fields are marked with *
My Review for All ITGB5 Products
Required fields are marked with *



