Recombinant Human IFNK Protein, His tagged

• Cat.No.: IFNK-68H
• Product Overview: Recombinant Human IFNK Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 38-207 aa
• Description: This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster.
• Form: Sterile PBS, pH7.4, 0.1% SKL
• Molecular Mass: 22 kDa
• AASequence: MHHHHHHHHHHRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: IFNK interferon, kappa [ Homo sapiens (human) ]
• Official Symbol: IFNK
• Synonyms: IFNK; interferon, kappa; interferon kappa; IFN-kappa; interferon-like protein; RP11-27J8.1
• Gene ID: 56832
• mRNA Refseq: NM_020124
• Protein Refseq: NP_064509
• MIM: 615326
• UniProt ID: Q9P0W0