Recombinant Human INTS8 protein, His-tagged
| Cat.No. : | INTS8-8966H |
| Product Overview : | Recombinant Human INTS8 protein(896-995 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 896-995 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | QVAILCQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | INTS8 integrator complex subunit 8 [ Homo sapiens ] |
| Official Symbol | INTS8 |
| Synonyms | INTS8; integrator complex subunit 8; C8orf52, chromosome 8 open reading frame 52; FLJ20530; INT8; MGC131633; protein kaonashi-1; C8orf52; |
| Gene ID | 55656 |
| mRNA Refseq | NM_017864 |
| Protein Refseq | NP_060334 |
| MIM | 611351 |
| UniProt ID | Q75QN2 |
| ◆ Recombinant Proteins | ||
| INTS8-8965H | Recombinant Human INTS8 protein, GST-tagged | +Inquiry |
| INTS8-8252M | Recombinant Mouse INTS8 Protein | +Inquiry |
| INTS8-4572M | Recombinant Mouse INTS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| INTS8-3410C | Recombinant Chicken INTS8 | +Inquiry |
| INTS8-2896Z | Recombinant Zebrafish INTS8 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INTS8 Products
Required fields are marked with *
My Review for All INTS8 Products
Required fields are marked with *
