Recombinant Human INTS9 Protein, GST-tagged
| Cat.No. : | INTS9-5084H |
| Product Overview : | Human INTS9 full-length ORF ( AAH25267.1, 1 a.a. - 658 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | INTS9 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).[supplied by OMIM |
| Molecular Mass : | 100.2 kDa |
| AA Sequence : | MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | INTS9 integrator complex subunit 9 [ Homo sapiens ] |
| Official Symbol | INTS9 |
| Synonyms | INTS9; integrator complex subunit 9; CPSF2L; FLJ10871; RC 74; protein related to CPSF subunits of 74 kDa; INT9; RC74; |
| Gene ID | 55756 |
| mRNA Refseq | NM_001145159 |
| Protein Refseq | NP_001138631 |
| MIM | 611352 |
| UniProt ID | Q9NV88 |
| ◆ Recombinant Proteins | ||
| INTS9-5084H | Recombinant Human INTS9 Protein, GST-tagged | +Inquiry |
| INTS9-626C | Recombinant Cynomolgus INTS9 Protein, His-tagged | +Inquiry |
| INTS9-2774C | Recombinant Chicken INTS9 | +Inquiry |
| INTS9-372C | Recombinant Cynomolgus Monkey INTS9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ints9-2435M | Recombinant Mouse Ints9 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INTS9-5187HCL | Recombinant Human INTS9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INTS9 Products
Required fields are marked with *
My Review for All INTS9 Products
Required fields are marked with *
