Recombinant Human IPO8 Protein, GST-tagged
Cat.No. : | IPO8-5075H |
Product Overview : | Human IPO8 partial ORF ( NP_006381.2, 949 a.a. - 1037 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. [provided by RefSeq |
Molecular Mass : | 35.53 kDa |
AA Sequence : | LDLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFENKGVLSAFNFGTVPSNN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IPO8 importin 8 [ Homo sapiens ] |
Official Symbol | IPO8 |
Synonyms | IPO8; importin 8; RAN binding protein 8 , RANBP8; importin-8; IMP8; imp8; RAN binding protein 8; ran-binding protein 8; RANBP8; FLJ21954; FLJ26580; |
Gene ID | 10526 |
mRNA Refseq | NM_001190995 |
Protein Refseq | NP_001177924 |
MIM | 605600 |
UniProt ID | O15397 |
◆ Recombinant Proteins | ||
IPO8-3874Z | Recombinant Zebrafish IPO8 | +Inquiry |
IPO8-5075H | Recombinant Human IPO8 Protein, GST-tagged | +Inquiry |
Ipo8-199M | Recombinant Mouse Ipo8 Protein, His/GST-tagged | +Inquiry |
IPO8-2286R | Recombinant Rhesus monkey IPO8 Protein, His-tagged | +Inquiry |
IPO8-2107R | Recombinant Rhesus Macaque IPO8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IPO8 Products
Required fields are marked with *
My Review for All IPO8 Products
Required fields are marked with *
0
Inquiry Basket