Recombinant Human IPO8 Protein, GST-tagged

Cat.No. : IPO8-5075H
Product Overview : Human IPO8 partial ORF ( NP_006381.2, 949 a.a. - 1037 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. [provided by RefSeq
Molecular Mass : 35.53 kDa
AA Sequence : LDLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFENKGVLSAFNFGTVPSNN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IPO8 importin 8 [ Homo sapiens ]
Official Symbol IPO8
Synonyms IPO8; importin 8; RAN binding protein 8 , RANBP8; importin-8; IMP8; imp8; RAN binding protein 8; ran-binding protein 8; RANBP8; FLJ21954; FLJ26580;
Gene ID 10526
mRNA Refseq NM_001190995
Protein Refseq NP_001177924
MIM 605600
UniProt ID O15397

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IPO8 Products

Required fields are marked with *

My Review for All IPO8 Products

Required fields are marked with *

0
cart-icon