Recombinant Human IRAK1BP1 Protein, GST-tagged
Cat.No. : | IRAK1BP1-5054H |
Product Overview : | Human IRAK1BP1 full-length ORF ( NP_001010844.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | IRAK1BP1 (Interleukin 1 Receptor Associated Kinase 1 Binding Protein 1) is a Protein Coding gene. |
Molecular Mass : | 55.5 kDa |
AA Sequence : | MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IRAK1BP1 interleukin-1 receptor-associated kinase 1 binding protein 1 [ Homo sapiens ] |
Official Symbol | IRAK1BP1 |
Synonyms | IRAK1BP1; interleukin-1 receptor-associated kinase 1 binding protein 1; interleukin-1 receptor-associated kinase 1-binding protein 1; AIP70; SIMPL; 4921528N06Rik; ActA binding protein 3; MGC138458; MGC138460; |
Gene ID | 134728 |
mRNA Refseq | NM_001010844 |
Protein Refseq | NP_001010844 |
UniProt ID | Q5VVH5 |
◆ Recombinant Proteins | ||
IRAK1BP1-2589H | Recombinant Human IRAK1BP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IRAK1BP1-5304C | Recombinant Chicken IRAK1BP1 | +Inquiry |
IRAK1BP1-27501TH | Recombinant Human IRAK1BP1, His-tagged | +Inquiry |
IRAK1BP1-1692H | Recombinant Human IRAK1BP1 Protein, His&GST-tagged | +Inquiry |
IRAK1BP1-2290R | Recombinant Rhesus monkey IRAK1BP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK1BP1-5172HCL | Recombinant Human IRAK1BP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRAK1BP1 Products
Required fields are marked with *
My Review for All IRAK1BP1 Products
Required fields are marked with *