Recombinant Human IRF8 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IRF8-4899H |
Product Overview : | IRF8 MS Standard C13 and N15-labeled recombinant protein (NP_002154) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Interferon consensus sequence-binding protein (ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IRF8 interferon regulatory factor 8 [ Homo sapiens (human) ] |
Official Symbol | IRF8 |
Synonyms | IRF8; interferon regulatory factor 8; ICSBP1, interferon consensus sequence binding protein 1; ICSBP; IRF 8; interferon consensus sequence binding protein 1; IRF-8; ICSBP1; H-ICSBP; |
Gene ID | 3394 |
mRNA Refseq | NM_002163 |
Protein Refseq | NP_002154 |
MIM | 601565 |
UniProt ID | Q02556 |
◆ Recombinant Proteins | ||
Irf8-1206M | Recombinant Mouse Irf8 Protein, MYC/DDK-tagged | +Inquiry |
IRF8-156H | Recombinant Human IRF8, His-tagged | +Inquiry |
IRF8-2122R | Recombinant Rhesus Macaque IRF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRF8-735Z | Recombinant Zebrafish IRF8 | +Inquiry |
IRF8-6967C | Recombinant Chicken IRF8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF8-5159HCL | Recombinant Human IRF8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF8 Products
Required fields are marked with *
My Review for All IRF8 Products
Required fields are marked with *
0
Inquiry Basket