Recombinant Human IRGM Protein, GST-tagged
Cat.No. : | IRGM-5030H |
Product Overview : | Human IRGM partial ORF ( XP_293893.3, 99 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Members of the p47 immunity-related GTPase (IRG) family, including IRGM, play an important role in the murine immune system; however, in humans this resistance system is greatly reduced. There is evidence that human IRGM plays a role in autophagy and control of intracellular mycobacteria (Bekpen et al., 2005; Singh et al., 2006 [PubMed 16888103]).[supplied by OMIM |
Molecular Mass : | 34.87 kDa |
AA Sequence : | TTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IRGM immunity-related GTPase family, M [ Homo sapiens ] |
Official Symbol | IRGM |
Synonyms | IRGM; immunity-related GTPase family, M; immunity related GTPase family, M1 , IRGM1; immunity-related GTPase family M protein; IFI1; LRG 47; LRG47; LRG-47-like protein; interferon-inducible protein 1; immunity-related GTPase family, M1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; IRGM1; LRG-47; MGC149263; MGC149264; |
Gene ID | 345611 |
mRNA Refseq | NM_001145805 |
Protein Refseq | NP_001139277 |
MIM | 608212 |
UniProt ID | A1A4Y4 |
◆ Recombinant Proteins | ||
IRGM-394H | Recombinant Human immunity-related GTPase family, M, His-tagged | +Inquiry |
IRGM-5030H | Recombinant Human IRGM Protein, GST-tagged | +Inquiry |
IRGM-2754R | Recombinant Rat IRGM Protein, His (Fc)-Avi-tagged | +Inquiry |
IRGM-3098R | Recombinant Rat IRGM Protein | +Inquiry |
IRGM-3118H | Recombinant Human IRGM protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRGM Products
Required fields are marked with *
My Review for All IRGM Products
Required fields are marked with *