Recombinant Human IRGM Protein, GST-tagged

• Cat.No.: IRGM-5030H
• Product Overview: Human IRGM partial ORF ( XP_293893.3, 99 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Members of the p47 immunity-related GTPase (IRG) family, including IRGM, play an important role in the murine immune system; however, in humans this resistance system is greatly reduced. There is evidence that human IRGM plays a role in autophagy and control of intracellular mycobacteria (Bekpen et al., 2005; Singh et al., 2006 [PubMed 16888103]).[supplied by OMIM
• Molecular Mass: 34.87 kDa
• AA Sequence: TTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IRGM immunity-related GTPase family, M [ Homo sapiens ]
• Official Symbol: IRGM
• Synonyms: IRGM; immunity-related GTPase family, M; immunity related GTPase family, M1 , IRGM1; immunity-related GTPase family M protein; IFI1; LRG 47; LRG47; LRG-47-like protein; interferon-inducible protein 1; immunity-related GTPase family, M1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; IRGM1; LRG-47; MGC149263; MGC149264
• Gene ID: 345611
• mRNA Refseq: NM_001145805
• Protein Refseq: NP_001139277
• MIM: 608212
• UniProt ID: A1A4Y4