Recombinant Human IRGM Protein, GST-tagged

Cat.No. : IRGM-5030H
Product Overview : Human IRGM partial ORF ( XP_293893.3, 99 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Members of the p47 immunity-related GTPase (IRG) family, including IRGM, play an important role in the murine immune system; however, in humans this resistance system is greatly reduced. There is evidence that human IRGM plays a role in autophagy and control of intracellular mycobacteria (Bekpen et al., 2005; Singh et al., 2006 [PubMed 16888103]).[supplied by OMIM
Molecular Mass : 34.87 kDa
AA Sequence : TTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IRGM immunity-related GTPase family, M [ Homo sapiens ]
Official Symbol IRGM
Synonyms IRGM; immunity-related GTPase family, M; immunity related GTPase family, M1 , IRGM1; immunity-related GTPase family M protein; IFI1; LRG 47; LRG47; LRG-47-like protein; interferon-inducible protein 1; immunity-related GTPase family, M1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; IRGM1; LRG-47; MGC149263; MGC149264;
Gene ID 345611
mRNA Refseq NM_001145805
Protein Refseq NP_001139277
MIM 608212
UniProt ID A1A4Y4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRGM Products

Required fields are marked with *

My Review for All IRGM Products

Required fields are marked with *

0
cart-icon
0
compare icon