Recombinant Human ISCA1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ISCA1-3241H |
Product Overview : | ISCA1 MS Standard C13 and N15-labeled recombinant protein (NP_112202) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions. |
Molecular Mass : | 14.2 kDa |
AA Sequence : | MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ISCA1 iron-sulfur cluster assembly 1 [ Homo sapiens (human) ] |
Official Symbol | ISCA1 |
Synonyms | ISCA1; iron-sulfur cluster assembly 1 homolog (S. cerevisiae); HBLD2, HESB like domain containing 2; iron-sulfur cluster assembly 1 homolog, mitochondrial; hIscA; ISA1; MGC4276; HESB like domain containing 2; iron sulfur assembly protein IscA; iron-sulfur assembly protein IscA; HESB-like domain-containing protein 2; HBLD2; RP11-507D14.2; |
Gene ID | 81689 |
mRNA Refseq | NM_030940 |
Protein Refseq | NP_112202 |
MIM | 611006 |
UniProt ID | Q9BUE6 |
◆ Recombinant Proteins | ||
ISCA1-3497HF | Recombinant Full Length Human ISCA1 Protein, GST-tagged | +Inquiry |
ISCA1-3100R | Recombinant Rat ISCA1 Protein | +Inquiry |
ISCA1-3081Z | Recombinant Zebrafish ISCA1 | +Inquiry |
ISCA1-2756R | Recombinant Rat ISCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Isca1-3581M | Recombinant Mouse Isca1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISCA1-5155HCL | Recombinant Human ISCA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ISCA1 Products
Required fields are marked with *
My Review for All ISCA1 Products
Required fields are marked with *
0
Inquiry Basket