Recombinant Human ISCA1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ISCA1-3241H
Product Overview : ISCA1 MS Standard C13 and N15-labeled recombinant protein (NP_112202) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions.
Molecular Mass : 14.2 kDa
AA Sequence : MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ISCA1 iron-sulfur cluster assembly 1 [ Homo sapiens (human) ]
Official Symbol ISCA1
Synonyms ISCA1; iron-sulfur cluster assembly 1 homolog (S. cerevisiae); HBLD2, HESB like domain containing 2; iron-sulfur cluster assembly 1 homolog, mitochondrial; hIscA; ISA1; MGC4276; HESB like domain containing 2; iron sulfur assembly protein IscA; iron-sulfur assembly protein IscA; HESB-like domain-containing protein 2; HBLD2; RP11-507D14.2;
Gene ID 81689
mRNA Refseq NM_030940
Protein Refseq NP_112202
MIM 611006
UniProt ID Q9BUE6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ISCA1 Products

Required fields are marked with *

My Review for All ISCA1 Products

Required fields are marked with *

0
cart-icon