Recombinant Human ISM2, His-tagged
| Cat.No. : | ISM2-119H |
| Product Overview : | Recombinant Human Isthmin-2/ISM2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu27-Tyr571) of Human ISM2 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 27-571 a.a. |
| Description : | Isthmin-2 belongs to the isthmin family. Isthmins represent a novel family of vertebrate secreted proteins containing one copy of the thrombospondin type 1 repeat (TSR), which in mammals is shared by several proteins with diverse biological functions, including cell adhesion, angiogenesis, and patterning of developing nervous system. Isthmin-2 is a secreted protein and contains a TSR and a C-terminal AMOP domain (adhesion-associated domain in MUC4 and other proteins), characteristic of extracellular proteins involved in adhesion processes. |
| AA Sequence : | LPVKKPRLRGPRPGSLTRLAEVSASPDPRPLKEEEEAPLLPRTHLQAEPHQHGCWTVTEPAAMTP GNTTPPRTPEVTPLRLELQKLPGLANTTLSTPNPDTQASASPDPRPLREEEEARLLPRTHLQAEL HQHGCWTVTEPAALTPGNATPPRTQEVTPLLLELQKLPELVHATLSTPNPDNQVTIKVVEDPQAE VSIDLLAEPSNPPPQDTLSWLPALWSFLWGDYKGEEKDRAPGEKGEEKEEDEDYPSEDIEGEDQE DKEEDEEEQALWFNGTTDNWDQGWLAPGDWVFKDSVSYDYEPQKEWSPWSPCSGNCSTGKQQRTR PCGYGCTATETRTCDLPSCPGTEDKDTLGLPSEEWKLLARNATDMHDQDVDSCEKWLNCKSDFLI KYLSQMLRDLPSCPCAYPLEAMDSPVSLQDEHQGRSFRWRDASGPRERLDIYQPTARFCLRSMLS GESSTLAAQHCCYDEDSRLLTRGKGAGMPNLISTDFSPKLHFKFDTTPWILCKGDWSRLHAVLPP NNGRACTDNPLEEEYLAQLQEAKEYVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| ◆ Recombinant Proteins | ||
| ISM2-171H | Recombinant Human ISM2 protein, His&Myc-tagged | +Inquiry |
| ISM2-1154H | Recombinant Human ISM2 | +Inquiry |
| ISM2-172H | Recombinant Human ISM2 protein, His&Myc-tagged | +Inquiry |
| ISM2-119H | Recombinant Human ISM2, His-tagged | +Inquiry |
| ISM2-3174H | Recombinant Human ISM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ISM2-5146HCL | Recombinant Human ISM2 293 Cell Lysate | +Inquiry |
| ISM2-5145HCL | Recombinant Human ISM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISM2 Products
Required fields are marked with *
My Review for All ISM2 Products
Required fields are marked with *
