Recombinant Human ISOC2 Protein, GST-tagged

Cat.No. : ISOC2-5010H
Product Overview : Human ISOC2 full-length ORF ( AAH17344.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ISOC2 (Isochorismatase Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is ISOC1.
Molecular Mass : 48.7 kDa
AA Sequence : MAAARPSLGRVLPGSSVLFLCDMQEKFRHNIAYFPQIVSVAARMLKVARLLEVPVMLTEQYPQGLGPTVPELGTEGLRPLAKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILNTTLDLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVGDAVHPQFKEIQKLIKEPAPDSGLLGLFQGQNSLLH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ISOC2 isochorismatase domain containing 2 [ Homo sapiens ]
Official Symbol ISOC2
Synonyms ISOC2; isochorismatase domain containing 2; isochorismatase domain-containing protein 2, mitochondrial; FLJ23469; FLJ18582;
Gene ID 79763
mRNA Refseq NM_001136201
Protein Refseq NP_001129673
MIM 612928
UniProt ID Q96AB3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ISOC2 Products

Required fields are marked with *

My Review for All ISOC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon