Recombinant Human ITCH Protein, GST-tagged

Cat.No. : ITCH-5004H
Product Overview : Human ITCH partial ORF ( NP_113671, 92 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is a closely related member of the NEDD4-like protein family. This family of proteins are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. This encoded protein contains four tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. It can act as a transcriptional corepressor of p45/NFE2 and may participate in the regulation of immune responses by modifying Notch-mediated signaling. It is highly similar to the mouse Itch protein, which has been implicated in the regulation and differentiation of erythroid and lymphoid cells. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : DVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSESASQNDDGSRSKDETRVSTNGSDDPEDAGAGE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ITCH itchy E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol ITCH
Synonyms ITCH; itchy E3 ubiquitin protein ligase; itchy (mouse homolog) E3 ubiquitin protein ligase , itchy E3 ubiquitin protein ligase homolog (mouse); E3 ubiquitin-protein ligase Itchy homolog; AIP4; NFE2-associated polypeptide 1; atrophin-1 interacting protein 4; itchy E3 ubiquitin protein ligase homolog; dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4)); AIF4; NAPP1; dJ468O1.1;
Gene ID 83737
mRNA Refseq NM_001257137
Protein Refseq NP_001244066
MIM 606409
UniProt ID Q96J02

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITCH Products

Required fields are marked with *

My Review for All ITCH Products

Required fields are marked with *

0
cart-icon