Recombinant Human ITCH Protein, GST-tagged

• Cat.No.: ITCH-5004H
• Product Overview: Human ITCH partial ORF ( NP_113671, 92 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is a closely related member of the NEDD4-like protein family. This family of proteins are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. This encoded protein contains four tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. It can act as a transcriptional corepressor of p45/NFE2 and may participate in the regulation of immune responses by modifying Notch-mediated signaling. It is highly similar to the mouse Itch protein, which has been implicated in the regulation and differentiation of erythroid and lymphoid cells. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: DVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSESASQNDDGSRSKDETRVSTNGSDDPEDAGAGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITCH itchy E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: ITCH
• Synonyms: ITCH; itchy E3 ubiquitin protein ligase; itchy (mouse homolog) E3 ubiquitin protein ligase , itchy E3 ubiquitin protein ligase homolog (mouse); E3 ubiquitin-protein ligase Itchy homolog; AIP4; NFE2-associated polypeptide 1; atrophin-1 interacting protein 4; itchy E3 ubiquitin protein ligase homolog; dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4)); AIF4; NAPP1; dJ468O1.1
• Gene ID: 83737
• mRNA Refseq: NM_001257137
• Protein Refseq: NP_001244066
• MIM: 606409
• UniProt ID: Q96J02