Recombinant Human ITGA11 Protein, GST-tagged

Cat.No. : ITGA11-5001H
Product Overview : Human ITGA11 partial ORF ( NP_001004439, 793 a.a. - 893 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein contains an I domain, is expressed in muscle tissue, dimerizes with beta 1 integrin in vitro, and appears to bind collagen in this form. Therefore, the protein may be involved in attaching muscle tissue to the extracellular matrix. Alternative transcriptional splice variants have been found for this gene, but their biological validity is not determined. [provided by RefSeq
Molecular Mass : 36.85 kDa
AA Sequence : LDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAVEATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ITGA11 integrin, alpha 11 [ Homo sapiens ]
Official Symbol ITGA11
Synonyms ITGA11; integrin, alpha 11; integrin alpha-11; HsT18964;
Gene ID 22801
mRNA Refseq NM_001004439
Protein Refseq NP_001004439
MIM 604789
UniProt ID Q9UKX5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGA11 Products

Required fields are marked with *

My Review for All ITGA11 Products

Required fields are marked with *

0
cart-icon