Recombinant Human ITGA5 protein, His-tagged

• Cat.No.: ITGA5-2935H
• Product Overview: Recombinant Human ITGA5 protein(874-995 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 874-995 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: PINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSY
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ITGA5 integrin, alpha 5 (fibronectin receptor, alpha polypeptide) [ Homo sapiens ]
• Official Symbol: ITGA5
• Synonyms: ITGA5; integrin, alpha 5 (fibronectin receptor, alpha polypeptide); FNRA; integrin alpha-5; CD49e; VLA-5; integrin alpha-F; CD49 antigen-like family member E; fibronectin receptor subunit alpha; fibronectin receptor, alpha subunit; very late activation protein 5, alpha subunit; VLA5A
• Gene ID: 3678
• mRNA Refseq: NM_002205
• Protein Refseq: NP_002196
• MIM: 135620
• UniProt ID: P08648