Recombinant Human ITGA5 protein, His-tagged
| Cat.No. : | ITGA5-2935H |
| Product Overview : | Recombinant Human ITGA5 protein(874-995 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 874-995 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | PINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ITGA5 integrin, alpha 5 (fibronectin receptor, alpha polypeptide) [ Homo sapiens ] |
| Official Symbol | ITGA5 |
| Synonyms | ITGA5; integrin, alpha 5 (fibronectin receptor, alpha polypeptide); FNRA; integrin alpha-5; CD49e; VLA-5; integrin alpha-F; CD49 antigen-like family member E; fibronectin receptor subunit alpha; fibronectin receptor, alpha subunit; very late activation protein 5, alpha subunit; VLA5A; |
| Gene ID | 3678 |
| mRNA Refseq | NM_002205 |
| Protein Refseq | NP_002196 |
| MIM | 135620 |
| UniProt ID | P08648 |
| ◆ Recombinant Proteins | ||
| ITGA5-8351M | Recombinant Mouse ITGA5 Protein | +Inquiry |
| ITGA5-2341H | Recombinant Human ITGA5 Protein, His-tagged | +Inquiry |
| ITGA5-164H | Recombinant Human ITGA5 & ITGB6, Flag & His tagged | +Inquiry |
| ITGA5-1211H | Recombinant Human ITGA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ITGA5-078H | Recombinant Human ITGA5 Protein, C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGA5-5132HCL | Recombinant Human ITGA5 293 Cell Lysate | +Inquiry |
| ITGA5-213HKCL | Human ITGA5 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA5 Products
Required fields are marked with *
My Review for All ITGA5 Products
Required fields are marked with *
