Recombinant Human ITGAE Protein, GST-tagged
Cat.No. : | ITGAE-4990H |
Product Overview : | Human ITGAE partial ORF ( NP_002199, 57 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation. [provided by RefSeq |
Molecular Mass : | 38.39 kDa |
AA Sequence : | SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGAE integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide) [ Homo sapiens ] |
Official Symbol | ITGAE |
Synonyms | ITGAE; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); integrin alpha-E; CD103; HUMINAE; HML-1 antigen; integrin alpha-IEL; mucosal lymphocyte 1 antigen; antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide; MGC141996; |
Gene ID | 3682 |
mRNA Refseq | NM_002208 |
Protein Refseq | NP_002199 |
MIM | 604682 |
UniProt ID | P38570 |
◆ Recombinant Proteins | ||
Itgae-3600M | Recombinant Mouse Itgae Protein, Myc/DDK-tagged | +Inquiry |
ITGAE-8357M | Recombinant Mouse ITGAE Protein | +Inquiry |
ITGAE-3118H | Recombinant Human ITGAE protein, His-tagged | +Inquiry |
Itgae-6960M | Recombinant Mouse Itgae protein, His & T7-tagged | +Inquiry |
ITGAE-4990H | Recombinant Human ITGAE Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGAE Products
Required fields are marked with *
My Review for All ITGAE Products
Required fields are marked with *