Recombinant Human ITGBL1 protein, GST-tagged
| Cat.No. : | ITGBL1-184H |
| Product Overview : | Recombinant Human ITGBL1 Protein(NP_001258683.1)(145-494 aa) is expressed from E. coli with a GST Tag. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 145-494 aa |
| Description : | This gene encodes a beta integrin-related protein that is a member of the EGF-like protein family. The encoded protein contains integrin-like cysteine-rich repeats. Alternative splicing results in multiple transcript variants. |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4), 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
| Bio-activity : | Not tested |
| AA Sequence : | NSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP |
| Endotoxin : | <1.0 EU per μg protein as determined by the LAL method. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Applications : | on: Blocking peptide |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200μl sterile water for short-term storage. Reconstitution with 200μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
| Gene Name | ITGBL1 |
| Official Symbol | ITGBL1 |
| Synonyms | OSCP; TIED |
| Gene ID | 9358 |
| mRNA Refseq | NM_001271754.2 |
| Protein Refseq | NP_001258683.1 |
| MIM | 604234 |
| UniProt ID | O95965 |
| ◆ Recombinant Proteins | ||
| ITGBL1-2950Z | Recombinant Zebrafish ITGBL1 | +Inquiry |
| Itgbl1-4334M | Recombinant Mouse Itgbl1 protein, His&Myc-tagged | +Inquiry |
| ITGBL1-1309H | Recombinant Human ITGBL1 protein, His&Myc-tagged | +Inquiry |
| ITGBL1-3301H | Recombinant Human ITGBL1 Protein (Met1-Pro494), C-His tagged | +Inquiry |
| ITGBL1-4335H | Recombinant Human ITGBL1 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGBL1-5120HCL | Recombinant Human ITGBL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGBL1 Products
Required fields are marked with *
My Review for All ITGBL1 Products
Required fields are marked with *
