Recombinant Human ITGBL1 protein, GST-tagged

• Cat.No.: ITGBL1-184H
• Product Overview: Recombinant Human ITGBL1 Protein(NP_001258683.1)(145-494 aa) is expressed from E. coli with a GST Tag.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 145-494 aa
• Description: This gene encodes a beta integrin-related protein that is a member of the EGF-like protein family. The encoded protein contains integrin-like cysteine-rich repeats. Alternative splicing results in multiple transcript variants.
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4), 5% trehalose and 5% mannitol are added as protectants before lyophilization.
• Bio-activity: Not tested
• AA Sequence: NSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP
• Endotoxin: <1.0 EU per μg protein as determined by the LAL method.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Applications: on:
  Blocking peptide
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200μl sterile water for short-term storage.
  Reconstitution with 200μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).

Gene Information

• Gene Name: ITGBL1
• Official Symbol: ITGBL1
• Synonyms: OSCP; TIED
• Gene ID: 9358
• mRNA Refseq: NM_001271754.2
• Protein Refseq: NP_001258683.1
• MIM: 604234
• UniProt ID: O95965