Recombinant Human ITGBL1 protein, GST-tagged
Cat.No. : | ITGBL1-184H |
Product Overview : | Recombinant Human ITGBL1 Protein(NP_001258683.1)(145-494 aa) is expressed from E. coli with a GST Tag. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 145-494 aa |
Description : | This gene encodes a beta integrin-related protein that is a member of the EGF-like protein family. The encoded protein contains integrin-like cysteine-rich repeats. Alternative splicing results in multiple transcript variants. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4), 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
Bio-activity : | Not tested |
AA Sequence : | NSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP |
Endotoxin : | <1.0 EU per μg protein as determined by the LAL method. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Applications : | on: Blocking peptide |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200μl sterile water for short-term storage. Reconstitution with 200μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
Gene Name | ITGBL1 |
Official Symbol | ITGBL1 |
Synonyms | OSCP; TIED |
Gene ID | 9358 |
mRNA Refseq | NM_001271754.2 |
Protein Refseq | NP_001258683.1 |
MIM | 604234 |
UniProt ID | O95965 |
◆ Recombinant Proteins | ||
ITGBL1-2950Z | Recombinant Zebrafish ITGBL1 | +Inquiry |
ITGBL1-3118R | Recombinant Rat ITGBL1 Protein | +Inquiry |
ITGBL1-4648M | Recombinant Mouse ITGBL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25020MF | Recombinant Full Length Mouse Integrin Beta-Like Protein 1(Itgbl1) Protein, His&Myc-Tagged | +Inquiry |
ITGBL1-184H | Recombinant Human ITGBL1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGBL1-5120HCL | Recombinant Human ITGBL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGBL1 Products
Required fields are marked with *
My Review for All ITGBL1 Products
Required fields are marked with *
0
Inquiry Basket